SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|523520169|ref|YP_008206249.1| from Lactobacillus rhamnosus LOCK908

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|523520169|ref|YP_008206249.1|
Domain Number 1 Region: 19-117
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 3.38e-25
Family HxlR-like 0.0041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|523520169|ref|YP_008206249.1|
Sequence length 128
Comment Transcriptional regulator, HxlR family [Lactobacillus rhamnosus LOCK908]
Sequence
MDATVTSKTECQSQQVALCPKFQHTFEILGKKWNGLILEVLLNNGNSRFKDIAQLIPRCS
DRVLVERLKELEGEGLIDRLTHKDSDLIEYALTDKGRALNSVMAAAHAWGDAWVTDEECH
ANEKQKNA
Download sequence
Identical sequences A0A2J2GVS8
gi|523520169|ref|YP_008206249.1| WP_019728312.1.14021 WP_019728312.1.18871 WP_019728312.1.44898 WP_019728312.1.70401 WP_019728312.1.71250 WP_019728312.1.8089 WP_019728312.1.85765 WP_019728312.1.87473 WP_019728312.1.9147 WP_019728312.1.94635 WP_019728312.1.98686

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]