SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|523520384|ref|YP_008206464.1| from Lactobacillus rhamnosus LOCK908

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|523520384|ref|YP_008206464.1|
Domain Number 1 Region: 2-74
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 2.43e-21
Family GntR-like transcriptional regulators 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|523520384|ref|YP_008206464.1|
Sequence length 125
Comment Transcriptional regulator, GntR family [Lactobacillus rhamnosus LOCK908]
Sequence
MEFDDKVPIYFQIKQYLYQAIITDRLKSGAQLPAVRQLAAELTVNVNTVQRALSELIQEG
VLVTRRGRGNFVTDDIKVLIDMKKRVIGSELDHLYRQLADLNLTADEMKDAFSQYVDEQE
EHHDN
Download sequence
Identical sequences A0A0D6U953 A0A249N383 A0A2A5L4F6 K8Q8M1
gi|523520384|ref|YP_008206464.1| gi|258540116|ref|YP_003174615.1| gi|385835756|ref|YP_005873531.1| WP_005685986.1.100 WP_005685986.1.100405 WP_005685986.1.100905 WP_005685986.1.101361 WP_005685986.1.101629 WP_005685986.1.10611 WP_005685986.1.11050 WP_005685986.1.14005 WP_005685986.1.14021 WP_005685986.1.14188 WP_005685986.1.14284 WP_005685986.1.14484 WP_005685986.1.14979 WP_005685986.1.15430 WP_005685986.1.16044 WP_005685986.1.16842 WP_005685986.1.18223 WP_005685986.1.18871 WP_005685986.1.23805 WP_005685986.1.24248 WP_005685986.1.25484 WP_005685986.1.3013 WP_005685986.1.30532 WP_005685986.1.32073 WP_005685986.1.32471 WP_005685986.1.33665 WP_005685986.1.36367 WP_005685986.1.36475 WP_005685986.1.36928 WP_005685986.1.37365 WP_005685986.1.37924 WP_005685986.1.39501 WP_005685986.1.40906 WP_005685986.1.41093 WP_005685986.1.42644 WP_005685986.1.4294 WP_005685986.1.43381 WP_005685986.1.44898 WP_005685986.1.45310 WP_005685986.1.46331 WP_005685986.1.48411 WP_005685986.1.49488 WP_005685986.1.49891 WP_005685986.1.50473 WP_005685986.1.51358 WP_005685986.1.51722 WP_005685986.1.52120 WP_005685986.1.53572 WP_005685986.1.53665 WP_005685986.1.56295 WP_005685986.1.57122 WP_005685986.1.57153 WP_005685986.1.57217 WP_005685986.1.57253 WP_005685986.1.58801 WP_005685986.1.59185 WP_005685986.1.60726 WP_005685986.1.61450 WP_005685986.1.62246 WP_005685986.1.62275 WP_005685986.1.62506 WP_005685986.1.63053 WP_005685986.1.63979 WP_005685986.1.65997 WP_005685986.1.67264 WP_005685986.1.67395 WP_005685986.1.67667 WP_005685986.1.68137 WP_005685986.1.68272 WP_005685986.1.70097 WP_005685986.1.70398 WP_005685986.1.70401 WP_005685986.1.70502 WP_005685986.1.70613 WP_005685986.1.71250 WP_005685986.1.71459 WP_005685986.1.72024 WP_005685986.1.72055 WP_005685986.1.73229 WP_005685986.1.7391 WP_005685986.1.75513 WP_005685986.1.76218 WP_005685986.1.76241 WP_005685986.1.76540 WP_005685986.1.77423 WP_005685986.1.78781 WP_005685986.1.79700 WP_005685986.1.80214 WP_005685986.1.80670 WP_005685986.1.8089 WP_005685986.1.81670 WP_005685986.1.8195 WP_005685986.1.84719 WP_005685986.1.85245 WP_005685986.1.85765 WP_005685986.1.85933 WP_005685986.1.86216 WP_005685986.1.87473 WP_005685986.1.87509 WP_005685986.1.90835 WP_005685986.1.91456 WP_005685986.1.9147 WP_005685986.1.91665 WP_005685986.1.92011 WP_005685986.1.93242 WP_005685986.1.93450 WP_005685986.1.94635 WP_005685986.1.95093 WP_005685986.1.95170 WP_005685986.1.96492 WP_005685986.1.97125 WP_005685986.1.9713 WP_005685986.1.98686 WP_005685986.1.9911 WP_005685986.1.99535 gi|258508932|ref|YP_003171683.1| gi|523517416|ref|YP_008203498.1| 568703.LGG_01937 568704.LC705_01925 gi|258508932|ref|YP_003171683.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]