SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|523520478|ref|YP_008206558.1| from Lactobacillus rhamnosus LOCK908

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|523520478|ref|YP_008206558.1|
Domain Number 1 Region: 8-136
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 1.91e-29
Family FUR-like 0.0072
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|523520478|ref|YP_008206558.1|
Sequence length 150
Comment Zinc uptake regulation protein ZUR [Lactobacillus rhamnosus LOCK908]
Sequence
MDNTAIALKQLKQHGYRVTKQRESMVDYLGRNQHRYTAVTILDRYMRTQFPGVSHDTIYR
NVKSFIEMGIVESRMEDDQIVVKLQCDFQHPHHHHFICTNCGKVIELKMCPLNYFEEQVP
GAKIQSHNFELYGLCAACQEHADRLKNANR
Download sequence
Identical sequences A0A171J7I0 A0A249N3G0 A0A2A5L315 C2JZW1 K8QEU1
gi|258509007|ref|YP_003171758.1| WP_005687189.1.100 WP_005687189.1.100405 WP_005687189.1.101629 WP_005687189.1.10611 WP_005687189.1.14021 WP_005687189.1.14484 WP_005687189.1.14979 WP_005687189.1.15430 WP_005687189.1.16044 WP_005687189.1.16842 WP_005687189.1.18871 WP_005687189.1.23805 WP_005687189.1.24248 WP_005687189.1.25484 WP_005687189.1.3013 WP_005687189.1.32073 WP_005687189.1.32471 WP_005687189.1.33665 WP_005687189.1.36367 WP_005687189.1.36475 WP_005687189.1.36928 WP_005687189.1.37365 WP_005687189.1.40906 WP_005687189.1.41093 WP_005687189.1.42644 WP_005687189.1.4294 WP_005687189.1.43381 WP_005687189.1.44898 WP_005687189.1.45310 WP_005687189.1.49891 WP_005687189.1.51358 WP_005687189.1.51722 WP_005687189.1.53572 WP_005687189.1.53665 WP_005687189.1.56295 WP_005687189.1.57122 WP_005687189.1.57153 WP_005687189.1.57217 WP_005687189.1.57253 WP_005687189.1.58801 WP_005687189.1.59185 WP_005687189.1.60726 WP_005687189.1.62246 WP_005687189.1.62275 WP_005687189.1.62506 WP_005687189.1.63053 WP_005687189.1.63979 WP_005687189.1.67395 WP_005687189.1.68137 WP_005687189.1.70097 WP_005687189.1.70398 WP_005687189.1.70401 WP_005687189.1.70502 WP_005687189.1.70613 WP_005687189.1.71250 WP_005687189.1.71459 WP_005687189.1.72024 WP_005687189.1.72055 WP_005687189.1.73229 WP_005687189.1.7391 WP_005687189.1.75513 WP_005687189.1.76218 WP_005687189.1.76241 WP_005687189.1.76540 WP_005687189.1.78781 WP_005687189.1.79700 WP_005687189.1.8089 WP_005687189.1.81670 WP_005687189.1.8195 WP_005687189.1.84719 WP_005687189.1.85933 WP_005687189.1.86216 WP_005687189.1.87473 WP_005687189.1.87509 WP_005687189.1.91456 WP_005687189.1.9147 WP_005687189.1.91665 WP_005687189.1.92011 WP_005687189.1.93242 WP_005687189.1.93450 WP_005687189.1.94635 WP_005687189.1.95093 WP_005687189.1.95170 WP_005687189.1.96492 WP_005687189.1.97125 WP_005687189.1.9713 WP_005687189.1.98686 WP_005687189.1.9911 WP_005687189.1.99535 WP_005687189.1.99828 gi|258509007|ref|YP_003171758.1| gi|523520478|ref|YP_008206558.1| 568703.LGG_02012 568704.LC705_02010 gi|258540201|ref|YP_003174700.1| gi|385835838|ref|YP_005873613.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]