SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|523520486|ref|YP_008206566.1| from Lactobacillus rhamnosus LOCK908

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|523520486|ref|YP_008206566.1|
Domain Number 1 Region: 19-102
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 2.24e-19
Family ArsR-like transcriptional regulators 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|523520486|ref|YP_008206566.1|
Sequence length 111
Comment Transcriptional regulator, ArsR family [Lactobacillus rhamnosus LOCK908]
Sequence
MAAYSSAQQEALKEFKQDIGHLNALSNSSRQKLIMILGAADNHVGVSVNDLADAIGLSQP
ATSHHLKHLKDIGMVGSRREGNMVYYYLTLNDTIARLERLTNALKRQIAQA
Download sequence
Identical sequences A0A0J6XRT8 A0A1F0RPZ8 A0A249N2U0 A0A2A5L332 C2JZV3 F3MTF8 K8QJ01
568704.LC705_02020 gi|523517499|ref|YP_008203581.1| gi|258540211|ref|YP_003174710.1| gi|385835846|ref|YP_005873621.1| WP_005687178.1.11050 WP_005687178.1.12139 WP_005687178.1.14005 WP_005687178.1.14021 WP_005687178.1.14188 WP_005687178.1.14284 WP_005687178.1.16044 WP_005687178.1.16842 WP_005687178.1.18223 WP_005687178.1.18502 WP_005687178.1.18871 WP_005687178.1.25484 WP_005687178.1.27841 WP_005687178.1.30532 WP_005687178.1.32073 WP_005687178.1.32471 WP_005687178.1.36928 WP_005687178.1.37365 WP_005687178.1.37924 WP_005687178.1.39501 WP_005687178.1.40906 WP_005687178.1.41093 WP_005687178.1.42644 WP_005687178.1.4294 WP_005687178.1.43381 WP_005687178.1.43697 WP_005687178.1.44898 WP_005687178.1.45310 WP_005687178.1.48411 WP_005687178.1.49488 WP_005687178.1.51722 WP_005687178.1.52120 WP_005687178.1.53572 WP_005687178.1.53665 WP_005687178.1.56295 WP_005687178.1.57122 WP_005687178.1.57217 WP_005687178.1.59185 WP_005687178.1.60726 WP_005687178.1.61450 WP_005687178.1.65997 WP_005687178.1.67031 WP_005687178.1.67264 WP_005687178.1.68137 WP_005687178.1.68272 WP_005687178.1.70401 WP_005687178.1.70502 WP_005687178.1.70613 WP_005687178.1.71250 WP_005687178.1.72055 WP_005687178.1.76218 WP_005687178.1.76241 WP_005687178.1.76540 WP_005687178.1.77423 WP_005687178.1.78781 WP_005687178.1.79700 WP_005687178.1.80214 WP_005687178.1.80670 WP_005687178.1.8089 WP_005687178.1.81670 WP_005687178.1.84719 WP_005687178.1.85245 WP_005687178.1.85765 WP_005687178.1.86216 WP_005687178.1.87473 WP_005687178.1.87509 WP_005687178.1.90835 WP_005687178.1.9147 WP_005687178.1.91665 WP_005687178.1.92011 WP_005687178.1.93242 WP_005687178.1.93450 WP_005687178.1.94635 WP_005687178.1.95093 WP_005687178.1.96492 WP_005687178.1.98686 WP_005687178.1.9911 WP_005687178.1.99535 WP_005687178.1.99828 gi|523520486|ref|YP_008206566.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]