SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|523520580|ref|YP_008206660.1| from Lactobacillus rhamnosus LOCK908

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|523520580|ref|YP_008206660.1|
Domain Number 1 Region: 12-147
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 2.69e-25
Family MarR-like transcriptional regulators 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|523520580|ref|YP_008206660.1|
Sequence length 149
Comment Transcriptional regulator of fatty acid biosynthesis FabT [Lactobacillus rhamnosus LOCK908]
Sequence
MSQKPSVKRINDKLIRVYSDILRMEEEELRKSQFRDLGIKEMHTIDAIGIHATPSSSDVA
KKLHVTQGTLSFAINNLARKGYVERLHLESDKRVVNLRLSRKGRLMYRAHLAFHQKMVAS
FVKGFTEPQIELIERALDNLNEFIDEYRH
Download sequence
Identical sequences WP_019728479.1.14021 WP_019728479.1.18871 WP_019728479.1.44898 WP_019728479.1.70401 WP_019728479.1.71250 WP_019728479.1.8089 WP_019728479.1.85765 WP_019728479.1.87473 WP_019728479.1.9147 WP_019728479.1.94635 WP_019728479.1.98686 gi|523520580|ref|YP_008206660.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]