SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|523520788|ref|YP_008206868.1| from Lactobacillus rhamnosus LOCK908

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|523520788|ref|YP_008206868.1|
Domain Number 1 Region: 6-80
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 1.02e-21
Family GntR-like transcriptional regulators 0.027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|523520788|ref|YP_008206868.1|
Sequence length 128
Comment Transcriptional regulator, GntR family [Lactobacillus rhamnosus LOCK908]
Sequence
MRLTIDLASKVPLYQQIRDAIVNGIATGTLANGTVLPSIRALGNELGVNLHTVNKAYQAL
QQEGFVVIQRGRGAVVQSRGAPEQAVENVLRPALEKVVAEAVARNLDRSTVHKMIDQLYD
QLTGSEDR
Download sequence
Identical sequences A0A0E3CLK9 A0A1F0S5S1 A0A249N440 A0A2A5L641 C2JYZ4
gi|385836154|ref|YP_005873929.1| gi|523517820|ref|YP_008203902.1| 568704.LC705_02326 gi|258540517|ref|YP_003175016.1| gi|523520788|ref|YP_008206868.1| WP_005686116.1.100905 WP_005686116.1.11050 WP_005686116.1.14021 WP_005686116.1.14284 WP_005686116.1.14979 WP_005686116.1.16044 WP_005686116.1.16842 WP_005686116.1.18223 WP_005686116.1.18502 WP_005686116.1.18871 WP_005686116.1.24248 WP_005686116.1.25484 WP_005686116.1.27841 WP_005686116.1.30532 WP_005686116.1.32073 WP_005686116.1.32471 WP_005686116.1.36928 WP_005686116.1.37365 WP_005686116.1.37924 WP_005686116.1.41093 WP_005686116.1.42644 WP_005686116.1.4294 WP_005686116.1.43381 WP_005686116.1.43697 WP_005686116.1.44898 WP_005686116.1.45310 WP_005686116.1.48411 WP_005686116.1.50473 WP_005686116.1.51358 WP_005686116.1.51722 WP_005686116.1.52120 WP_005686116.1.53665 WP_005686116.1.56295 WP_005686116.1.57153 WP_005686116.1.57217 WP_005686116.1.58801 WP_005686116.1.59185 WP_005686116.1.60726 WP_005686116.1.61450 WP_005686116.1.67031 WP_005686116.1.67264 WP_005686116.1.68137 WP_005686116.1.68272 WP_005686116.1.70097 WP_005686116.1.70401 WP_005686116.1.70502 WP_005686116.1.70613 WP_005686116.1.71250 WP_005686116.1.71459 WP_005686116.1.72024 WP_005686116.1.72055 WP_005686116.1.76218 WP_005686116.1.76241 WP_005686116.1.76540 WP_005686116.1.78781 WP_005686116.1.80670 WP_005686116.1.8089 WP_005686116.1.81670 WP_005686116.1.84719 WP_005686116.1.85765 WP_005686116.1.86216 WP_005686116.1.87473 WP_005686116.1.87509 WP_005686116.1.9147 WP_005686116.1.93242 WP_005686116.1.93450 WP_005686116.1.94635 WP_005686116.1.96492 WP_005686116.1.97125 WP_005686116.1.98686 WP_005686116.1.9911 WP_005686116.1.99535

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]