SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|523520837|ref|YP_008206917.1| from Lactobacillus rhamnosus LOCK908

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|523520837|ref|YP_008206917.1|
Domain Number 1 Region: 6-102
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 3.84e-23
Family PadR-like 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|523520837|ref|YP_008206917.1|
Sequence length 110
Comment Transcriptional regulator, PadR family [Lactobacillus rhamnosus LOCK908]
Sequence
MQPSSQMLKGILEGAILRIIQQGDIYGYGLHEKLGTLGFGNIPEGTIYPLLLKLQKNKLI
VGVRRPTGNGPDRKYYHLTDAGQDALADFQQQWQQLAQAMAQLNQGGTES
Download sequence
Identical sequences A0A0D6U6F8 A0A1F0RYY7 A0A2A5L209 K8Q6T0
gi|258509372|ref|YP_003172123.1| gi|258540565|ref|YP_003175064.1| gi|523517871|ref|YP_008203953.1| gi|523520837|ref|YP_008206917.1| WP_005687855.1.100 WP_005687855.1.100405 WP_005687855.1.100905 WP_005687855.1.101629 WP_005687855.1.11050 WP_005687855.1.12139 WP_005687855.1.14021 WP_005687855.1.14188 WP_005687855.1.14284 WP_005687855.1.14484 WP_005687855.1.14979 WP_005687855.1.15430 WP_005687855.1.16044 WP_005687855.1.16842 WP_005687855.1.18223 WP_005687855.1.18871 WP_005687855.1.23805 WP_005687855.1.24248 WP_005687855.1.27841 WP_005687855.1.3013 WP_005687855.1.30532 WP_005687855.1.32073 WP_005687855.1.32471 WP_005687855.1.33665 WP_005687855.1.36475 WP_005687855.1.36928 WP_005687855.1.37365 WP_005687855.1.37924 WP_005687855.1.40906 WP_005687855.1.41093 WP_005687855.1.42644 WP_005687855.1.4294 WP_005687855.1.43381 WP_005687855.1.44898 WP_005687855.1.45310 WP_005687855.1.48411 WP_005687855.1.50473 WP_005687855.1.51358 WP_005687855.1.51722 WP_005687855.1.52120 WP_005687855.1.53572 WP_005687855.1.53665 WP_005687855.1.56295 WP_005687855.1.57122 WP_005687855.1.57153 WP_005687855.1.57217 WP_005687855.1.57253 WP_005687855.1.58801 WP_005687855.1.59185 WP_005687855.1.60726 WP_005687855.1.61450 WP_005687855.1.62246 WP_005687855.1.62275 WP_005687855.1.62506 WP_005687855.1.63053 WP_005687855.1.63979 WP_005687855.1.67031 WP_005687855.1.67264 WP_005687855.1.67395 WP_005687855.1.68137 WP_005687855.1.68272 WP_005687855.1.70097 WP_005687855.1.70398 WP_005687855.1.70401 WP_005687855.1.70502 WP_005687855.1.70613 WP_005687855.1.71250 WP_005687855.1.71459 WP_005687855.1.72024 WP_005687855.1.72055 WP_005687855.1.73229 WP_005687855.1.7391 WP_005687855.1.76218 WP_005687855.1.76241 WP_005687855.1.77423 WP_005687855.1.78781 WP_005687855.1.79700 WP_005687855.1.80214 WP_005687855.1.80670 WP_005687855.1.8089 WP_005687855.1.81670 WP_005687855.1.8195 WP_005687855.1.84719 WP_005687855.1.85245 WP_005687855.1.85765 WP_005687855.1.86216 WP_005687855.1.87473 WP_005687855.1.87509 WP_005687855.1.90835 WP_005687855.1.9147 WP_005687855.1.91665 WP_005687855.1.92011 WP_005687855.1.93242 WP_005687855.1.93450 WP_005687855.1.94635 WP_005687855.1.95170 WP_005687855.1.96492 WP_005687855.1.97125 WP_005687855.1.9713 WP_005687855.1.98686 WP_005687855.1.9911 WP_005687855.1.99535 WP_005687855.1.99828 gi|385836203|ref|YP_005873978.1| 568703.LGG_02377 568704.LC705_02374 gi|258509372|ref|YP_003172123.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]