SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|523520861|ref|YP_008206941.1| from Lactobacillus rhamnosus LOCK908

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|523520861|ref|YP_008206941.1|
Domain Number 1 Region: 6-143
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 5.53e-22
Family Transcriptional regulator Rrf2 0.0083
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|523520861|ref|YP_008206941.1|
Sequence length 146
Comment Transcriptional regulator, BadM/Rrf2 family [Lactobacillus rhamnosus LOCK908]
Sequence
MAFSVAFSQALEITAYVNAKSQAQHEDYLSIQKISEMLNIPVPSIKKISSTLKKSGILTS
KTGLNGGLRLAKTPQTITVYEILTAIEGTAPLFKLHQEIDPAAFVNGERVTSWLTASTNV
LNRAEDAMVQVLKQTSIADLAEAAEA
Download sequence
Identical sequences A0A1F0RPP9 A0A2G9ITQ9 C2JYR7
gi|523520861|ref|YP_008206941.1| WP_005692227.1.14021 WP_005692227.1.16842 WP_005692227.1.18871 WP_005692227.1.24248 WP_005692227.1.25484 WP_005692227.1.27841 WP_005692227.1.32073 WP_005692227.1.36928 WP_005692227.1.37924 WP_005692227.1.41093 WP_005692227.1.43381 WP_005692227.1.44898 WP_005692227.1.45310 WP_005692227.1.53665 WP_005692227.1.56295 WP_005692227.1.57153 WP_005692227.1.59185 WP_005692227.1.60726 WP_005692227.1.67031 WP_005692227.1.70097 WP_005692227.1.70401 WP_005692227.1.70613 WP_005692227.1.71250 WP_005692227.1.72024 WP_005692227.1.76218 WP_005692227.1.8089 WP_005692227.1.81670 WP_005692227.1.84719 WP_005692227.1.85765 WP_005692227.1.86216 WP_005692227.1.87473 WP_005692227.1.87509 WP_005692227.1.9147 WP_005692227.1.93242 WP_005692227.1.94635 WP_005692227.1.97125 WP_005692227.1.98686 WP_005692227.1.99535 gi|258540586|ref|YP_003175085.1| 568704.LC705_02395 gi|385836227|ref|YP_005874002.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]