SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|523520883|ref|YP_008206963.1| from Lactobacillus rhamnosus LOCK908

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|523520883|ref|YP_008206963.1|
Domain Number 1 Region: 8-100
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 3.25e-22
Family ArsR-like transcriptional regulators 0.0048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|523520883|ref|YP_008206963.1|
Sequence length 110
Comment putative transcriptional regulator [Lactobacillus rhamnosus LOCK908]
Sequence
MTATTLRLVESAKLAEAERIFKLLSNPTRLQMLKLLEQQVLNVSKLSELLGVEQSVVSHQ
LALLRKHQLVSAKRVGKANYYQLDDPHIIAVIDAMLAHADHVARGKQHGQ
Download sequence
Identical sequences A0A0D6U8U6 A0A1F0RJA2 A0A2A5L474 K8QDI9
gi|258540608|ref|YP_003175107.1| gi|523520883|ref|YP_008206963.1| WP_005686809.1.100 WP_005686809.1.100405 WP_005686809.1.100905 WP_005686809.1.101629 WP_005686809.1.10611 WP_005686809.1.11050 WP_005686809.1.12139 WP_005686809.1.14005 WP_005686809.1.14021 WP_005686809.1.14188 WP_005686809.1.14284 WP_005686809.1.14484 WP_005686809.1.14979 WP_005686809.1.15430 WP_005686809.1.16044 WP_005686809.1.16842 WP_005686809.1.18223 WP_005686809.1.18502 WP_005686809.1.18871 WP_005686809.1.23805 WP_005686809.1.24248 WP_005686809.1.25484 WP_005686809.1.27841 WP_005686809.1.3013 WP_005686809.1.30532 WP_005686809.1.32073 WP_005686809.1.32471 WP_005686809.1.33665 WP_005686809.1.36367 WP_005686809.1.36475 WP_005686809.1.36928 WP_005686809.1.37365 WP_005686809.1.37924 WP_005686809.1.39501 WP_005686809.1.40906 WP_005686809.1.41093 WP_005686809.1.42644 WP_005686809.1.4294 WP_005686809.1.43381 WP_005686809.1.43697 WP_005686809.1.44898 WP_005686809.1.45310 WP_005686809.1.46331 WP_005686809.1.48411 WP_005686809.1.49488 WP_005686809.1.49891 WP_005686809.1.50473 WP_005686809.1.51358 WP_005686809.1.51722 WP_005686809.1.52120 WP_005686809.1.53572 WP_005686809.1.53665 WP_005686809.1.56295 WP_005686809.1.57122 WP_005686809.1.57153 WP_005686809.1.57217 WP_005686809.1.57253 WP_005686809.1.58801 WP_005686809.1.59185 WP_005686809.1.60726 WP_005686809.1.61450 WP_005686809.1.62246 WP_005686809.1.62275 WP_005686809.1.62506 WP_005686809.1.63053 WP_005686809.1.63979 WP_005686809.1.65997 WP_005686809.1.67031 WP_005686809.1.67264 WP_005686809.1.67395 WP_005686809.1.67667 WP_005686809.1.68137 WP_005686809.1.68272 WP_005686809.1.70097 WP_005686809.1.70398 WP_005686809.1.70401 WP_005686809.1.70502 WP_005686809.1.70613 WP_005686809.1.71250 WP_005686809.1.71459 WP_005686809.1.72024 WP_005686809.1.72055 WP_005686809.1.73229 WP_005686809.1.7391 WP_005686809.1.75513 WP_005686809.1.76218 WP_005686809.1.76241 WP_005686809.1.77423 WP_005686809.1.78781 WP_005686809.1.79700 WP_005686809.1.80214 WP_005686809.1.80670 WP_005686809.1.8089 WP_005686809.1.81670 WP_005686809.1.8195 WP_005686809.1.84719 WP_005686809.1.85245 WP_005686809.1.85765 WP_005686809.1.85933 WP_005686809.1.86216 WP_005686809.1.87473 WP_005686809.1.87509 WP_005686809.1.90835 WP_005686809.1.91456 WP_005686809.1.9147 WP_005686809.1.91665 WP_005686809.1.92011 WP_005686809.1.93242 WP_005686809.1.93450 WP_005686809.1.94635 WP_005686809.1.95093 WP_005686809.1.95170 WP_005686809.1.96492 WP_005686809.1.97125 WP_005686809.1.9713 WP_005686809.1.98686 WP_005686809.1.9911 WP_005686809.1.99535 WP_005686809.1.99828 gi|258509413|ref|YP_003172164.1| 568703.LGG_02418 568704.LC705_02417 gi|385836248|ref|YP_005874023.1| gi|523517922|ref|YP_008204004.1| gi|258509413|ref|YP_003172164.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]