SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|523520987|ref|YP_008207067.1| from Lactobacillus rhamnosus LOCK908

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|523520987|ref|YP_008207067.1|
Domain Number 1 Region: 5-166
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 1.34e-34
Family PadR-like 0.0077
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|523520987|ref|YP_008207067.1|
Sequence length 178
Comment Transcriptional regulator, PadR family [Lactobacillus rhamnosus LOCK908]
Sequence
MNNEQIILGLLYKHSRTGYELNEVFKNIFSHFYDASFGMIYPTLRRLEKNGLVSKKMVVQ
SGRPNKNQYAITEEGKKVFEDSLDASVVPDTRHSDFLMRLYFGEYESDTALQAMIQQQIG
WLGMQIDKLQLRLKEWPNMTKTQHLSFSVGIAEYEAQIKTLKAYLQTDEPKGNDSEHR
Download sequence
Identical sequences A0A1F0S0K5 A0A2G9ITK3 C2JVD4 K8Q6Q8
gi|523520987|ref|YP_008207067.1| gi|258540720|ref|YP_003175219.1| 568704.LC705_02529 WP_005691234.1.100905 WP_005691234.1.12139 WP_005691234.1.14021 WP_005691234.1.16044 WP_005691234.1.16842 WP_005691234.1.18871 WP_005691234.1.24248 WP_005691234.1.25484 WP_005691234.1.27841 WP_005691234.1.32073 WP_005691234.1.36928 WP_005691234.1.37924 WP_005691234.1.40906 WP_005691234.1.41093 WP_005691234.1.43381 WP_005691234.1.43697 WP_005691234.1.44898 WP_005691234.1.45310 WP_005691234.1.53572 WP_005691234.1.53665 WP_005691234.1.56295 WP_005691234.1.57122 WP_005691234.1.57153 WP_005691234.1.58801 WP_005691234.1.59185 WP_005691234.1.60726 WP_005691234.1.67031 WP_005691234.1.70097 WP_005691234.1.70401 WP_005691234.1.70502 WP_005691234.1.70613 WP_005691234.1.71250 WP_005691234.1.72024 WP_005691234.1.76218 WP_005691234.1.8089 WP_005691234.1.81670 WP_005691234.1.84719 WP_005691234.1.85765 WP_005691234.1.86216 WP_005691234.1.87473 WP_005691234.1.87509 WP_005691234.1.9147 WP_005691234.1.91665 WP_005691234.1.92011 WP_005691234.1.93242 WP_005691234.1.94635 WP_005691234.1.97125 WP_005691234.1.98686 WP_005691234.1.99535 gi|385836351|ref|YP_005874126.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]