SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|523521091|ref|YP_008207171.1| from Lactobacillus rhamnosus LOCK908

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|523521091|ref|YP_008207171.1|
Domain Number 1 Region: 17-134
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 9.93e-18
Family MarR-like transcriptional regulators 0.0088
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|523521091|ref|YP_008207171.1|
Sequence length 140
Comment Transcriptional regulator [Lactobacillus rhamnosus LOCK908]
Sequence
MTMKKQYLSASQSVNQFNRLFSPVSTADIPLNQQNLLFWMATDSTPRTPTNLAKEMHVTK
AAITKASGPLLERGLLDKQPDPEDCRSFKLVLSEAGEKAVEDLGPEYLGNLERLYNELGE
KKYLKLIKLLSQATGVTVKE
Download sequence
Identical sequences A0A249N4X1 C2JUV3 K8Q5Z5
gi|523521091|ref|YP_008207171.1| gi|523518134|ref|YP_008204216.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]