SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for KII60803 from Thelohanellus kitauei

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  KII60803
Domain Number 1 Region: 18-66
Classification Level Classification E-value
Superfamily Transcription factor IIA (TFIIA), alpha-helical domain 0.000000000105
Family Transcription factor IIA (TFIIA), alpha-helical domain 0.0013
Further Details:      
 
Domain Number 2 Region: 66-115
Classification Level Classification E-value
Superfamily Transcription factor IIA (TFIIA), beta-barrel domain 0.00000000654
Family Transcription factor IIA (TFIIA), beta-barrel domain 0.0021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) KII60803
Sequence length 120
Comment pep supercontig:ASM82789v1:scaffold05602:8207:8613:1 gene:RF11_16281 transcript:KII60803 gene_biotype:protein_coding transcript_biotype:protein_coding description:Transcription initiation factor IIA subunit 2
Sequence
MEPSKPTEGAEQKASMTQVYRVTTPGTTLQESLKEMIDSQQISPFLATDIMSIFDKTIVN
VIENKCRNKIQIKGRIIDYRNCESLWTLMVKDANFKDFTSTKTVAYAKIIAFDGKNSSNK
Download sequence
Identical sequences A0A0C2I6I3
KII60803

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]