SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for KII71945 from Thelohanellus kitauei

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  KII71945
Domain Number 1 Region: 91-186
Classification Level Classification E-value
Superfamily Tetracyclin repressor-like, C-terminal domain 7.21e-23
Family Tetracyclin repressor-like, C-terminal domain 0.002
Further Details:      
 
Domain Number 2 Region: 16-84
Classification Level Classification E-value
Superfamily Homeodomain-like 8.21e-16
Family Tetracyclin repressor-like, N-terminal domain 0.0051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) KII71945
Sequence length 194
Comment pep supercontig:ASM82789v1:scaffold00820-2:50:634:-1 gene:RF11_02170 transcript:KII71945 gene_biotype:protein_coding transcript_biotype:protein_coding description:hypothetical protein
Sequence
MYNQALFEEGRNVKVSKEQVRENRMRVVETASELFRERGYDGIGISELMSEAGLTHGGFY
KHFGSKADLLSEAMNCGFTRSAEKTEGVNREKFIEYYLSRQHRDDMGKGCVMSALGTDAA
RQSESIKETFAAGIERQLEVLGTENGTRADLINTIAHLVGALVLSRACPDNSALADEILD
VCRERLISHDSCKG
Download sequence
Identical sequences A0A0C2N6M0
KII71945

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]