SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for KII64693 from Thelohanellus kitauei

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  KII64693
Domain Number 1 Region: 1-86
Classification Level Classification E-value
Superfamily Ribosomal L11/L12e N-terminal domain 2.75e-26
Family Ribosomal L11/L12e N-terminal domain 0.00011
Further Details:      
 
Domain Number 2 Region: 75-148
Classification Level Classification E-value
Superfamily Ribosomal protein L11, C-terminal domain 5.36e-19
Family Ribosomal protein L11, C-terminal domain 0.0036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) KII64693
Sequence length 164
Comment pep supercontig:ASM82789v1:scaffold02295:114569:115106:1 gene:RF11_05483 transcript:KII64693 gene_biotype:protein_coding transcript_biotype:protein_coding description:60S ribosomal protein L12-3
Sequence
MGPKLDPNQVVEVIIKLVGGELGGASSLGPKLGPYGVPPKKVGEEIMKLTQAFKGYKVHV
KLRIQNRQATVEVVPTAPALILKALKEPPRDRKKVKNVKHNGNITFEQVLEIARTMRHKS
LAREFKGTVKEILGTCLSIGCTVEGVSPKVMTERINSGEVIAEK
Download sequence
Identical sequences A0A0C2J6D1
KII64693

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]