SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for KII68137 from Thelohanellus kitauei

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  KII68137
Domain Number 1 Region: 8-238
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 3.83e-52
Family Calponin-homology domain, CH-domain 0.0002
Further Details:      
 
Domain Number 2 Region: 1365-1446
Classification Level Classification E-value
Superfamily E set domains 0.0000000594
Family Filamin repeat (rod domain) 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) KII68137
Sequence length 1706
Comment pep supercontig:ASM82789v1:scaffold01135:135655:142427:1 gene:RF11_03019 transcript:KII68137 gene_biotype:protein_coding transcript_biotype:protein_coding description:Filamin-A
Sequence
MNEKCKIEMMTENDGWKSLQKEIFLRWINQCLEPLSVQISNLDRDLADGTKLVMLYEILS
GQKVKKYWENPNSYFQSVENVNTAFTGFRNDGIKFVNIEPNDIVKMDIKLTMGVIWSLIL
HYQISDRHSENEDDSTNHSGGKSILLQFINSKLTERNRKCVNFGSDWRDGKLLATLVDIL
RPGSISETEIETKTPEELCRKALLISYQELGIPKILTVEEFLNSNVDEISIMTFLSYYKN
TKVADVSVNTDQDLVPTPQYVDTSSKVSTLLSEQISEPDIQDTVSINPTERILDVSSTSH
EHIPPQFVEISKDEGPWEPAGDVEDTKSTRSVEVILIDSPHLKTIETEEVVFYLPSSSAK
SESEAKIVSEEIKIQEYVVKAPEIELDTSNQSIKSSSFDLEGCPQNSTSVTSEPVHDKSL
SDSSIVKSSIGNLPVDFLEMIHPDKLIESVPTFLIIRTIIVKENNYSYYGDYSCVIRSRC
GKIVLAQNFETSYIEKDTYILVERLHRITLTEGEFDISLQTGDVSKYIKTLMFKPIKNFI
IINPDQNHSSDEKTCSFEFFIHIDRFLIDYFKEFSSTFSETPKTITQFFRSQSEPFTEMI
APTHNHLIYFDDRELDEGAFIKGYLLTYFPNPQNVKVYFNGSLLDSINLSVPVSDSLISQ
HEIIQHMKIGINETINFRFKKLDMKKSDIICVGYDVSDGQQNARLADINDYGGKKYFASF
KTHSSRILFIFTIHRIYGPVYPLVRGYNSSNDIFRHLKSNQLNFSDLGQGTTQQTDVVHP
SSSVNGIVFSDDKMLMPLKLAKQGVLVLPNGQFGVLYDENISDENEVTDLEFFLPFTGKY
FFLMKGPSHFGSKKLFEAEKKTQLTNYLINLDEYVLANYHIPSNITFPIRLIIENFDYRP
LDQRALAVEIECPGSKPLKFTHIQMSFGHFWIPIKFKNASECAFKVLYDKKFTSDLNKIE
FGEIEKNKVIRDQINSEFYRSQDFYQIALDLRLTGSETLDLRFKGPYEYQVICVDFPEGI
CICTLYAPTNGDYLMIYQLDDTKDQCEIKLNITDIKQKDAKNLTNYYCVNNICRVQVPFR
IYRHDGKDNYYSPSFDHNTQSVSAKLISINEETPIEIKSYHNYFYTAEFVPKNRGLHLIQ
TTIESEHQALKLLPFPVLISPSISAHSLRWNGYFIDLTIPNINFKIVTNDSGVMVKTFMG
YSSRLSIFVFSWSEGPKTIKFKQFHNDIDLKLPTLTLQFLFVKPPEPRSSDLQLFDHHLL
SGSIQTHCNLKIRDIVSLGHDKLNQYDLTTMFLKSADNDRIHLSKCELFSNIQLTEVVFE
EHENCHISAYSKRGKYYSKYQQSIQITNQLQHFLYIKYDVKPSYPLKKVIHVLVDARHHS
KHSSSIDISVRIIGQDNYVPQLCVHDPIGACIFAFYPLLSGKYEVVVKLDGQEVRNSPII
LPVQENYTSKNRHSIELPNYAQNGSAIMKYKLRLPDYNPSRDSICSDEVSIDATLLEFYL
IHESSNNQRHLKQTVFDVSSESQHVYVNFINYGVHAICPIMTVNHNQIAFLPKFFFVKQR
LRIDCPLFPLLSYRMKEKHYEDIEIRKIESGNIICNYDTYFKSDYFGKGLCYIPIEKVEP
SSKIMIEILKKKGRCKTVLPIEICSIDWNQESYNHLIFNNTQLFSHLKNSNDQKVQEILS
GIEGKSFIYNGTMNFHQLTKVKEALK
Download sequence
Identical sequences A0A0C2N2P9
KII68137

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]