SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|427722068|ref|YP_007069345.1| from Leptolyngbya sp. PCC 7376

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|427722068|ref|YP_007069345.1|
Domain Number 1 Region: 13-96
Classification Level Classification E-value
Superfamily Homeodomain-like 2.1e-17
Family Tetracyclin repressor-like, N-terminal domain 0.005
Further Details:      
 
Domain Number 2 Region: 91-212
Classification Level Classification E-value
Superfamily Tetracyclin repressor-like, C-terminal domain 0.0000000000000377
Family Tetracyclin repressor-like, C-terminal domain 0.0091
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|427722068|ref|YP_007069345.1|
Sequence length 213
Comment TetR family transcriptional regulator [Leptolyngbya sp. PCC 7376]
Sequence
MPKPPRSVSKKQKQSRNPEATKAKILAAATEEFAQYGLSGARTGAIASRSGITKAMLCYY
FQNKETLYRRVLQGLVDDINQAFQPINWEALSPRQALEAVARSYITFEISNRHHGMLWFQ
EAIQNQGRYGAETGWQSGFHDIVDILERGIATGEFRPLDPFLTAINILGVCSFYFDAHEN
LKYLDAEKNLLSAEMVEQQTEAAIEFILAGVTL
Download sequence
Identical sequences K9PUB9
gi|427722068|ref|YP_007069345.1| WP_015132299.1.56710

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]