SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|427722198|ref|YP_007069475.1| from Leptolyngbya sp. PCC 7376

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|427722198|ref|YP_007069475.1|
Domain Number 1 Region: 590-669
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 1.63e-25
Family DEP domain 0.0011
Further Details:      
 
Domain Number 2 Region: 434-530
Classification Level Classification E-value
Superfamily Mechanosensitive channel protein MscS (YggB), C-terminal domain 4.05e-25
Family Mechanosensitive channel protein MscS (YggB), C-terminal domain 0.0015
Further Details:      
 
Domain Number 3 Region: 365-430
Classification Level Classification E-value
Superfamily Sm-like ribonucleoproteins 2.03e-16
Family Mechanosensitive channel protein MscS (YggB), middle domain 0.0012
Further Details:      
 
Domain Number 4 Region: 279-363
Classification Level Classification E-value
Superfamily Mechanosensitive channel protein MscS (YggB), transmembrane region 0.000000000366
Family Mechanosensitive channel protein MscS (YggB), transmembrane region 0.0053
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|427722198|ref|YP_007069475.1|
Sequence length 670
Comment mechanosensitive ion channel protein MscS [Leptolyngbya sp. PCC 7376]
Sequence
MRLIMAKEKWGICCKMKSKQDSALQGCVPMLFRFRFPRLRAIAIFCVASLMALGIALQPS
LAQSQSSSMSVERAAVVLDGRVLFRLGSIDGFTAERRVQSVNADLQRAIYTNPLDTSIPV
LVVQRSELTTIRVNKRHLLTVTEGDFRRGITPKEQAEEWAVTLKTALGRSQRERLPSYHE
QMLWRIVFALVGVSILSGLIRWGRRRLWRYWTQQAKNPQPQLIIPVLLCLEVGVWLVFFT
YVCEIWPLARRVRYQIVQFLGGAFTSGLITAGDTSYSLLDIAKLIALSLVLLIVVRGLTA
MFKSRILKITIPDRGMQDAIATLIQFVLMGLGLFILLQAWGIDLSALAIIASVLGVGLGF
GLQHIANNFISGWILLIERPVQVGDFINLGDVMGTVEVIGWRSTEIQTLDRVSIIVPNAE
LVQTRVINWSHGHSVSRLHLPLGVAYDSPIDTVHKAIMEAVQTHPEILQYPRPQLRFLGF
GDSSLDFDLLIWIRDPRLQFDIKSDLYYLLEANLRRYNISIPFPQRDLNLRATDINAILH
ERDQEQGDRPITPKTITPSTSNLLKDISKYSAILQTPKNITTAEITQLIKQMRSDDGLDI
KDHRFRLTKYPKSFIGSEAVSWIVQTQKATREAAVRLGQLLVERGIIHHVTDEHAFKDEY
LFYRFYEDEG
Download sequence
Identical sequences K9PUP6
gi|427722198|ref|YP_007069475.1| WP_015132427.1.56710

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]