SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|427722219|ref|YP_007069496.1| from Leptolyngbya sp. PCC 7376

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|427722219|ref|YP_007069496.1|
Domain Number 1 Region: 568-665
Classification Level Classification E-value
Superfamily OmpA-like 0.000000000131
Family OmpA-like 0.0032
Further Details:      
 
Weak hits

Sequence:  gi|427722219|ref|YP_007069496.1|
Domain Number - Region: 54-226,312-354
Classification Level Classification E-value
Superfamily ARM repeat 0.000288
Family HEAT repeat 0.048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|427722219|ref|YP_007069496.1|
Sequence length 684
Comment OmpA/MotB domain-containing protein [Leptolyngbya sp. PCC 7376]
Sequence
MEQNSEGLHPAKRPESNGDRPVANPTDASNPSQAVAANIVSSNDPQQQNPPDENVLQELL
ANLVFTSSQHPDFTPLEQKIKQIEHQLYDPEEVIKLLMPIISELLNRKVMESKDSIVRAI
VPIIDEVIVEKTGEDKVAMIRAIANLIPGAIDQQVRSNSDDLVEALAPAMGEIIKQQIRI
ERDAMVDALYPVIGSTISKYMQEVVQEINSRVESTLTPAGIRRKVQAKIQGVSEAELIFQ
ESMPFQIQAIFLIHKQSGLIIASAKQEKEADKQESSLEGDLMAGMLTAMRSFASECAIEP
GNTSELKEIEYESFQILMEVAGYCYMATVIKGNIEQAYIENMRQSLANIILNYDRDQSIH
YYSGDPSSVDDAVQEELDNLILYAPKTDKVGKKGWPIALLLLIFIPLLAWGGWRTWQDKQ
LKALAAIESKIDLELDVDPQLAVYPVESVAQKVKGDRQIILSGKVPSARLKEKAKAITDK
QLTLLAEPSEWQVINEIITVEVEPATEVTIAEVVRLTDVFNQNENTIITTEYSDRQVTVS
GHLRTEVQLQQIADGFSQIPGVDNVLIASTAKAFPIDQRLYFGTNAKAINPKDAQEKLPS
IQEFLQQYPDMKLRIIGHIHPSETEQKASLAEQRAIAVRDSLLGLGIAEARLEIVAAPSA
PPNLTQADDSWLSRCVRFERIMEQ
Download sequence
Identical sequences K9PVW0
gi|427722219|ref|YP_007069496.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]