SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|427722343|ref|YP_007069620.1| from Leptolyngbya sp. PCC 7376

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|427722343|ref|YP_007069620.1|
Domain Number - Region: 9-134
Classification Level Classification E-value
Superfamily Transmembrane di-heme cytochromes 0.0196
Family Formate dehydrogenase N, cytochrome (gamma) subunit 0.066
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|427722343|ref|YP_007069620.1|
Sequence length 154
Comment hypothetical protein Lepto7376_0347 [Leptolyngbya sp. PCC 7376]
Sequence
MAIPESVKVWSQFAHPAMMWVLFGLAIYAMYLGFQSRRTRSAEKEVRKELIKKQFGFKHH
QIGAALLAFMVLGTIGGMTVTYINNDKLFVGPHLIVGLAMTGIIAVSASLTPFMQRGNEL
ARITHIGLNTALVGLFGWQAISGMDIVTKIIGRM
Download sequence
Identical sequences K9PV45
WP_015132572.1.56710 gi|427722343|ref|YP_007069620.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]