SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|427722362|ref|YP_007069639.1| from Leptolyngbya sp. PCC 7376

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|427722362|ref|YP_007069639.1|
Domain Number 1 Region: 2-126
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 0.0000000000000294
Family Dual specificity phosphatase-like 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|427722362|ref|YP_007069639.1|
Sequence length 147
Comment Beta-lactamase hydrolase-family protein [Leptolyngbya sp. PCC 7376]
Sequence
MDILNYLQVNDGLATSGQPRAEQFAEIANLEYRTVINLALPTSDDAIAHEGELVTAQDMN
YIHIPVIWEKPELSQYQLFCVVMEAHKPFKVWVHCAKNMRVSCFVALYGMKYLGFSDKEA
ASLISKIWQPNEVWSQFMSLAQSKNSH
Download sequence
Identical sequences K9PTN4
WP_015132591.1.56710 gi|427722362|ref|YP_007069639.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]