SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|427722914|ref|YP_007070191.1| from Leptolyngbya sp. PCC 7376

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|427722914|ref|YP_007070191.1|
Domain Number 1 Region: 2-210
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 2.15e-37
Family G proteins 0.00000151
Further Details:      
 
Domain Number 2 Region: 293-385
Classification Level Classification E-value
Superfamily EF-Tu/eEF-1alpha/eIF2-gamma C-terminal domain 8.63e-33
Family EF-Tu/eEF-1alpha/eIF2-gamma C-terminal domain 0.00000537
Further Details:      
 
Domain Number 3 Region: 198-292
Classification Level Classification E-value
Superfamily Translation proteins 2.16e-24
Family Elongation factors 0.000018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|427722914|ref|YP_007070191.1|
Sequence length 385
Comment translation elongation factor 1A (EF-1A/EF-Tu) [Leptolyngbya sp. PCC 7376]
Sequence
MKPYINVGTIGHVNHGKTTLTAALTTVLAKLHGGKPYEFRSINNAQTEEVMGLKIATSHV
EYETSTRRYSQTDHPTHTDYVQSIIVGAVPDARILVVSAAEDLMPETREQIRLCRQASVP
SIIVFINKCDMVEEEELLELVEMEVRKLLTEYGFPGDDLPVIRGSALGALHGEEQWEAKI
VELAEVLDTYISEAVQAIDQPFLMPIENVFSVQGRGTFVTGCIEQGILTVGDEVAIVGIK
ETVSTTCTEIERFRRLLHEGQAGENIGALLRGTKRDEVERGQVLAAPGSITPHTKFEAEV
YMLSKDEGGRHTPFFKGYRPQFYFRTVDVTGNIELPEGVEMVLPGDNIKMIVELIAPIAM
DEGLHFAIHEGSRTVGVGVVAKIFD
Download sequence
Identical sequences K9PXZ5
WP_015133132.1.56710 gi|427722914|ref|YP_007070191.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]