SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|427722993|ref|YP_007070270.1| from Leptolyngbya sp. PCC 7376

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|427722993|ref|YP_007070270.1|
Domain Number 1 Region: 385-449
Classification Level Classification E-value
Superfamily Sm-like ribonucleoproteins 0.0000000000000281
Family Mechanosensitive channel protein MscS (YggB), middle domain 0.0012
Further Details:      
 
Domain Number 2 Region: 461-551
Classification Level Classification E-value
Superfamily Mechanosensitive channel protein MscS (YggB), C-terminal domain 0.0000000000000575
Family Mechanosensitive channel protein MscS (YggB), C-terminal domain 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|427722993|ref|YP_007070270.1|
Sequence length 586
Comment mechanosensitive ion channel protein MscS [Leptolyngbya sp. PCC 7376]
Sequence
MAKIRGDRPIVRMTAPSKQSRSMAKFWRRFFLALCTCLLCWQMGTAIAQPKVEPLITPEV
SEPETLRGAPVVLGDDELFRIEARIASFDQEFRAKVISERLLEFAKNEELDVDYLQVIDN
EETQTSDVLVGTTLLATFADVDAVAAGKDRYDLAKEYQNIIRDKILEYRAAFSLRNILLG
VAYTIIATIILLLSFLAINLSLPRVHRYLRSCQSTWIPALKVFGIELLSSKQVVDLTLEV
FKIIRLTTWLTLIYIYGNLVLSFFPWTQGFARQLFGYARSAIFTVVKGSINYLPNLFFIA
VIIFVTSYTLKIFRFFFQEIEKEKITIQGFYAEWAIPTYKLVQVLVLVFAAIVAFPYLPG
AETPAFQGVSIFVGLLLSLGSSAAVANVVAGTIMTYTRAFRIGDRIQIGETKGDVLAKTL
LVTRIQTLKNEMITIPNSAVLSSHIVNYSEANNDPETPPLILYTTITLGYDVPWRKVHKV
LLDAVAVTPNTLLTPRPFILQTSLDDFYVSYEINAYTDKPKLMPDTYSHLHRNIQDKCNE
ADIEILSPHYRAARDGNQITIPADYLPEDYEPPSFRINNFPPQKNS
Download sequence
Identical sequences K9PX15
WP_015133210.1.56710 gi|427722993|ref|YP_007070270.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]