SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|427723079|ref|YP_007070356.1| from Leptolyngbya sp. PCC 7376

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|427723079|ref|YP_007070356.1|
Domain Number 1 Region: 119-300,435-588
Classification Level Classification E-value
Superfamily Class II aaRS and biotin synthetases 3.38e-103
Family Class II aminoacyl-tRNA synthetase (aaRS)-like, catalytic domain 0.000000008
Further Details:      
 
Domain Number 2 Region: 297-430
Classification Level Classification E-value
Superfamily GAD domain-like 4.25e-34
Family GAD domain 0.001
Further Details:      
 
Domain Number 3 Region: 1-104
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 5.14e-33
Family Anticodon-binding domain 0.0000866
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|427723079|ref|YP_007070356.1|
Sequence length 597
Comment aspartyl-tRNA synthetase [Leptolyngbya sp. PCC 7376]
Sequence
MRTHYCGELRSEHIDQTVTLCGWVDRRRDHGGVIFIDLRDRNGIVQIVSDPERTPDSYNN
ADASRSEYVVKIVGKVSPRKDGAINPKLPTGEVEIYADSIEILNSVNKQLPILVSASADG
DQVKEDLRLKYRYLDLRREAMAKNLQLRHTVTKAMRRFLEDAENFMEVETPILTRSTPEG
ARDYLVPSRVNAGDWYALPQSPQLFKQLLMVSGCDRYYQIARCFRDEDLRADRQPEFTQL
DMEMSFMSLDEILDLNERLICAIFKAAKGIDLPRPFPQITYAESMEKYGCDRPDTRFGLE
LVNVSDIVKDMGFKVFSGAVKNGGQVKVLPIPGGNDAISNVRIKPKGDLFNAACEMGAKG
LAFIRVREDGEIDTIGAIKDNLSDEQKTELLKRTGAEPGTLLLFGAGDTDTVNKSLDRVR
QLVGAEMGLIDQDQLNFVWVTEFPMFEYNADEKRLEALHHPFTAPNPEDLDDLSTARALA
YDIVLNGIEVGGGSLRIYQRDVQEKVFATIGLSDEEAKEKFGFLLEAFEYGTPPHGGIAY
GLDRLVMLMAQEESIRDVIAFPKTQQASCLLTEAPASVDDKQLKELYVASTVPDDED
Download sequence
Identical sequences K9PYE6
WP_015133295.1.56710 gi|427723079|ref|YP_007070356.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]