SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|427723128|ref|YP_007070405.1| from Leptolyngbya sp. PCC 7376

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|427723128|ref|YP_007070405.1|
Domain Number 1 Region: 121-185
Classification Level Classification E-value
Superfamily Sm-like ribonucleoproteins 0.00000000000173
Family Mechanosensitive channel protein MscS (YggB), middle domain 0.0044
Further Details:      
 
Domain Number 2 Region: 197-277
Classification Level Classification E-value
Superfamily Mechanosensitive channel protein MscS (YggB), C-terminal domain 0.000017
Family Mechanosensitive channel protein MscS (YggB), C-terminal domain 0.017
Further Details:      
 
Weak hits

Sequence:  gi|427723128|ref|YP_007070405.1|
Domain Number - Region: 41-119
Classification Level Classification E-value
Superfamily Mechanosensitive channel protein MscS (YggB), transmembrane region 0.000471
Family Mechanosensitive channel protein MscS (YggB), transmembrane region 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|427723128|ref|YP_007070405.1|
Sequence length 294
Comment mechanosensitive ion channel protein MscS [Leptolyngbya sp. PCC 7376]
Sequence
MSSLSLLNQLVFLAQTSEVEQPLSDNLLTDITFGKVAQAATTVAIAYGSFWMIQVATEWL
SERVPRRFRLTIKQALPFWKASILIVTLSYLLNLFLNLSEANLLALTGTIAVALGFAFKD
YASSVIAGLLALFEAPYRMGDRIQIADHYGEVVGYGLRGIKIQTPDDNVVTIPHNTTWTE
PISNANTGQLEAQVATSFYFAHHADAEKIVSILYQAAYSSKYTQLKLPIVVVMEEHYWGT
QFKLRCYPMDARDEFVYKTDLIRRAKQAFQRHKLPYPEFMRIVNEEGMGGELLR
Download sequence
Identical sequences K9PXD6
gi|427723128|ref|YP_007070405.1| WP_015133344.1.56710

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]