SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|427723319|ref|YP_007070596.1| from Leptolyngbya sp. PCC 7376

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|427723319|ref|YP_007070596.1|
Domain Number - Region: 73-177
Classification Level Classification E-value
Superfamily Helical scaffold and wing domains of SecA 0.00615
Family Helical scaffold and wing domains of SecA 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|427723319|ref|YP_007070596.1|
Sequence length 182
Comment hypothetical protein Lepto7376_1418 [Leptolyngbya sp. PCC 7376]
Sequence
MSMWRTIYFVDWKILLEHYKKETLVRALLDSEDTPNWAEVYHDLPISDHLYNAVATAYET
LRTGLPEKLRQDADSFMLPLITFEGYHQDLDHANLTSLIQSLNPQSVIKYALLADEIDWG
ALQEAYYEFCSDSTRKTIATYTNCENAEKSFRRGFLGYIEDEWIEPIYMAARKKQGIVVD
YR
Download sequence
Identical sequences K9PZ48
gi|427723319|ref|YP_007070596.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]