SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|427723327|ref|YP_007070604.1| from Leptolyngbya sp. PCC 7376

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|427723327|ref|YP_007070604.1|
Domain Number 1 Region: 7-156
Classification Level Classification E-value
Superfamily CheY-like 1.24e-29
Family CheY-related 0.0019
Further Details:      
 
Domain Number 2 Region: 143-308
Classification Level Classification E-value
Superfamily GAF domain-like 3.05e-18
Family GAF domain 0.0053
Further Details:      
 
Domain Number 3 Region: 333-497
Classification Level Classification E-value
Superfamily PP2C-like 0.00000000288
Family PP2C-like 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|427723327|ref|YP_007070604.1|
Sequence length 548
Comment protein serine/threonine phosphatase with GAF(s) sensor(s) [Leptolyngbya sp. PCC 7376]
Sequence
MSVANTNKLKLMVVDDETDNLDLLYRTFRREFRVYRAASAPEALDILASEGEMAIIISDQ
RMPVMNGTEFLSRTVEAYPNTIRILLTGYTDVEDLVGAINSGKVFKYITKPWKPDALMST
IHQAADTYKVLKQRTNQLERSLRQEELVNSLIRAIRESLDYESTLQTIVERLSESFHAEY
GVLYPVTEGQPQQLSAEKFSHPQTSSPLVEHVELAEKALQKGDRQLEQCVHDQSWLQLAV
PLIWKQKTYAILTFWHNIEDQAWSEGDLQLLDAVLEQSALAIAQAKLYQKIQQQTEQIRN
ELEVARQIQHNLLPQASPELDNAKIQGYCLPARQVGGDFFETYHHSNGDLWLAVGDVSGK
GVPAALFMASALSTLRQQLNQTTPASPKEIIQHLNRVMADDLFNSNCFITMVIACYQPEH
HKLTYANAGHIYPMLWSHHQPSSDSQPTYLKTRGIPIGILPEWQAEVEELTLKSRDVLLI
TSDGITEATVTKPELLQERNDMLNQEGLWRLILQNPERFDLYELLDRFNESTYTEQEDDQ
TIVSLEVM
Download sequence
Identical sequences K9PW95
WP_015133542.1.56710 gi|427723327|ref|YP_007070604.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]