SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|427723392|ref|YP_007070669.1| from Leptolyngbya sp. PCC 7376

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|427723392|ref|YP_007070669.1|
Domain Number 1 Region: 15-297
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 2.29e-58
Family Protein kinases, catalytic subunit 0.000098
Further Details:      
 
Domain Number 2 Region: 435-553
Classification Level Classification E-value
Superfamily Pentapeptide repeat-like 1.44e-29
Family Pentapeptide repeats 0.0014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|427723392|ref|YP_007070669.1|
Sequence length 560
Comment serine/threonine protein kinase [Leptolyngbya sp. PCC 7376]
Sequence
MSYCINPECENPKNPLRARTCQACGSSLFLHDRYKPLKSLGKGGFGATFLAVDLSLPGKP
SCVIKQLRPSTNVPHLFEMARELFEREAQTLGRIGNHPQVPRLLDYFETDKQFYLVQEYV
KGNNLQQEVKKNGVFSEAGARQFLSEILPMVQYIHSQQVIHRDIKPANLIRREQDKKLVL
IDFGAVKNRVNPEEAANTSDQTALTSFAVGTPGYAPPEQMAMRPVYASDIYAIGITCLYL
LTGKSPKDLDYNPNTGEMMWESFVDISNSFASVLRKMLESSVKHRYQSAEDALNALDMEP
YMESLAQGLSNGADGDFAGTTGGVNDPNSPTSDDDATGGPSTSANSRLAMAIRARRDRRK
GTGSVRQGLGSRGGQGGAKKNTLNRMAPGAGATPHKSSSSRFKSKNKTKGSGGKNSLGKL
DAKALQNAYKKGRRDFGQQNLLSISLPQSNLSGCIFHQSRMMRANFQGANLSNADFGKAN
LASANLRDANLGRAYFSYTNLSKADLRGADLSYAYLNYAIVDGTNLCGANLTNAKITEDQ
LKKAKTNWATIMPNGKRGLF
Download sequence
Identical sequences K9PWI5
WP_015133606.1.56710 gi|427723392|ref|YP_007070669.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]