SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|427723393|ref|YP_007070670.1| from Leptolyngbya sp. PCC 7376

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|427723393|ref|YP_007070670.1|
Domain Number 1 Region: 204-397
Classification Level Classification E-value
Superfamily PheT/TilS domain 1.2e-66
Family B3/B4 domain of PheRS, PheT 0.00000584
Further Details:      
 
Domain Number 2 Region: 36-195
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 8e-45
Family Myf domain 0.0014
Further Details:      
 
Domain Number 3 Region: 484-697
Classification Level Classification E-value
Superfamily Class II aaRS and biotin synthetases 4.08e-41
Family Class II aminoacyl-tRNA synthetase (aaRS)-like, catalytic domain 0.00012
Further Details:      
 
Domain Number 4 Region: 710-808
Classification Level Classification E-value
Superfamily Anticodon-binding domain of PheRS 2.88e-30
Family Anticodon-binding domain of PheRS 0.0005
Further Details:      
 
Domain Number 5 Region: 411-491
Classification Level Classification E-value
Superfamily Putative DNA-binding domain 0.000000000000623
Family Domains B1 and B5 of PheRS-beta, PheT 0.0034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|427723393|ref|YP_007070670.1|
Sequence length 809
Comment phenylalanyl-tRNA synthetase subunit beta [Leptolyngbya sp. PCC 7376]
Sequence
MRISLNWLKEFVDITLSPEELAKTLTVAGFEVEEIEDRRALADGVVIGKVVNREQHPNAD
KLSVCQVDIGVEELSTIVCGAKNVRADIFVPVATLGSYLPTVDLKLKPTKLRGVQSSGMI
CSLSEIGLEKDSEGIHIFEQPDLKPGQDVRPLLGLDDVVLDLTATANRADALSMVGVARE
VAALTGVDVKLPEIPEAIAPPSIVEVTVEDSEVCPAYIGTVIEGVKTEPSPDWLKFRLQA
AGTRPINNIVDITNYVLLEWGQPLHAFDREKLQDIAGSNAVALGVRFAKEGEVLTTLDGQ
ERKLVERNVVITAGDQPVALAGVMGGENSEVSDGTTNIVLEAALFDPVAVRRSSRAQSLR
SEASTRYERGVNQVELDRAAQRAIALLQELAGGKVVAKGSHDSRPDPNSRPKITLRLARI
HEILGHVQKGGEVFDVPIADAERILTDLNCQLESVGEGVWDVTVPPYRYRDLEREIDLIE
EVARLYGYDHFCETLPAQTAAGYLSANEVVNRKLRESFRSVGLTEVVHYSLVKPELADIK
LDNPLFEEYSALRRELITGLVDAFAYNQAQGNGALNAFEIGRIFWRVDDQQTMEADSLAG
ILGGEIAPDGTWTTGGKGKSMTWFEAKGLLEAVFAQLNLDISYRTETKVEKLHPGRTASL
WLQGRQVGIFGQLHPQVRQEKDLMDAVYVFELKLDMLQTVLSRPSQQVPVFKKFSTYPAS
TRDLAFFSGTEVTVGELEQAMKKAAKKLLADVELFDEYCGKGVPEGQRSLAFSLKYRALD
KTLKDEEIDPVHQKVRDTLVKKFKVTLRS
Download sequence
Identical sequences K9PY60
WP_015133607.1.56710 gi|427723393|ref|YP_007070670.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]