SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|427723722|ref|YP_007070999.1| from Leptolyngbya sp. PCC 7376

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|427723722|ref|YP_007070999.1|
Domain Number 1 Region: 40-88
Classification Level Classification E-value
Superfamily Homeodomain-like 0.000000466
Family Cgl2762-like 0.024
Further Details:      
 
Weak hits

Sequence:  gi|427723722|ref|YP_007070999.1|
Domain Number - Region: 147-227
Classification Level Classification E-value
Superfamily PIN domain-like 0.0103
Family 5' to 3' exonuclease catalytic domain 0.019
Further Details:      
 
Domain Number - Region: 1-35
Classification Level Classification E-value
Superfamily Zinc beta-ribbon 0.0459
Family Transcriptional factor domain 0.06
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|427723722|ref|YP_007070999.1|
Sequence length 231
Comment Insertion element protein [Leptolyngbya sp. PCC 7376]
Sequence
MECPECQSTHIRKNGKKKGKQNHICVDCGRQFIDHYSQLGYSNAFKRECLKMYVNGMGFR
AIERVKGVHHTTVITWVKQVGALLPDAYEPEEMPQVGELDELQTFVGAKKNKVWLWTAVD
HFQPGILAWTIGDRSAETFKPLWAIVSLWRCFFYVTDGWKVYPIFVPDGDQIVSKTYMTR
VEGENTRLRHYLARLHRKTLCYSKSVEMLEHSIRLLIHYLKFWDVPIPRPS
Download sequence
Identical sequences K9PXK9
gi|427722083|ref|YP_007069360.1| gi|427722117|ref|YP_007069394.1| gi|427722906|ref|YP_007070183.1| gi|427723208|ref|YP_007070485.1| gi|427723722|ref|YP_007070999.1| gi|427725464|ref|YP_007072741.1| gi|427725576|ref|YP_007072853.1| gi|427726208|ref|YP_007073485.1| gi|427726209|ref|YP_007073486.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]