SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|427723762|ref|YP_007071039.1| from Leptolyngbya sp. PCC 7376

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|427723762|ref|YP_007071039.1|
Domain Number 1 Region: 15-273
Classification Level Classification E-value
Superfamily PP2C-like 9.68e-17
Family PP2C-like 0.0049
Further Details:      
 
Weak hits

Sequence:  gi|427723762|ref|YP_007071039.1|
Domain Number - Region: 519-565,621-682
Classification Level Classification E-value
Superfamily TPR-like 0.00294
Family Tetratricopeptide repeat (TPR) 0.03
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|427723762|ref|YP_007071039.1|
Sequence length 709
Comment protein phosphatase 2C domain-containing protein [Leptolyngbya sp. PCC 7376]
Sequence
MQKQHEQPDNLLVIDIETKPNKGQDAHLYLSYLDSFVLAVFDGLGGRSGMMGSEHGARVA
SRSAKTSTYSFFQDLINKHQKLDKTNAFDLQRFIQQDLRKSKNDYERTSNKPSSRIKSNL
KPSKDIASTTLALANISKSRSSQKALDLDVAWIGDSRVYFLSSRKGLQQLTQDDVKEYKD
DFDSVSNSGAPMTQYLTPDMDSDVGINFNHFSIEEPGLVIVSTDGAFDGLHPWYFEYLLL
FFLQSSGSMREYEQKLSEYLRERRVGDDITLILQPLAFGNNFSSIQEKYQERYRTVEDLA
NSCRELKNYAEVWNKYRVNYEERIEQTASQVSNDSIALLCDSEVINELIDIDLDFNDPEQ
SISKKSIQPPRGSQQFNEERAPLEQPISYGANQKNPQERINELGIKESKFSNQPNYQNPS
LDIDNSPSQNTLPPIQPLSYNTNQDHPSDISKTTNRVTAPSEEPNTNVYVPDQKKQAQPS
NPPYPSHVKNKKIDLLAKASGNKISTHCIDYIYIAKGLLYENKDYNSAIQTIIQILKSNC
EEIPALSFLGLAYFMESNSGVLAPLPKTDKWANVFRQTLNIIEKKKYLEKDSQHESIRIS
LIILVECLTQVEISSKVFSSSELKEIEAICRKIKTYREQNPHPWYVTGKIYAAQSKTIQK
KEEKNYIEQAKKDFRYAQNIYEQRGDTRRVNECNKEIKKLDSVWNKRIF
Download sequence
Identical sequences K9PXI9
WP_015133972.1.56710 gi|427723762|ref|YP_007071039.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]