SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|427723765|ref|YP_007071042.1| from Leptolyngbya sp. PCC 7376

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|427723765|ref|YP_007071042.1|
Domain Number - Region: 263-357
Classification Level Classification E-value
Superfamily Collagen-binding domain 0.000458
Family Collagen-binding domain 0.0054
Further Details:      
 
Domain Number - Region: 174-265
Classification Level Classification E-value
Superfamily Influenza hemagglutinin (stalk) 0.00174
Family Influenza hemagglutinin (stalk) 0.0026
Further Details:      
 
Domain Number - Region: 52-80
Classification Level Classification E-value
Superfamily Rubredoxin-like 0.00418
Family Rubredoxin 0.063
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|427723765|ref|YP_007071042.1|
Sequence length 360
Comment hypothetical protein Lepto7376_1889 [Leptolyngbya sp. PCC 7376]
Sequence
MYSSLDCLFFDPIQLTLLIKGNINRFSKAIFPKSYRKEHNSTRTKSEIHYIMPTYKCRSC
GNEYKQETPPSKCEVTPHCKNAVFFVDLSSHGQLLTLNIQLESKNNDLGSINSDLMNQNK
ILSEDNKHLRNQTRTQRKKSVYKNKSLFLSTRNINIFNSVLLFISFSVCGGGYWGYTKYQ
ELKFSSQSLAANLRSTRQSLNSRIEELESDKSLLLSQIKELESDKSFLEERKESLKNKVD
TIDDNYVDILKNNHNLNVIREGWNTSWENSLSPNDSSDALSTFIIPEDSYLDITLYNLAE
GADADFELYHHRGEKVENSRQETEGGDELDNFFVESGSYYVKVWLYGNKSTSFTLKVSRR
Download sequence
Identical sequences K9PYJ0
gi|427723765|ref|YP_007071042.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]