SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|427723812|ref|YP_007071089.1| from Leptolyngbya sp. PCC 7376

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|427723812|ref|YP_007071089.1|
Domain Number 1 Region: 164-433
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 2.45e-70
Family Extended AAA-ATPase domain 0.0000000552
Further Details:      
 
Domain Number 2 Region: 420-616
Classification Level Classification E-value
Superfamily FtsH protease domain-like 2.75e-66
Family FtsH protease domain-like 0.00000245
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|427723812|ref|YP_007071089.1|
Sequence length 621
Comment membrane protease FtsH catalytic subunit [Leptolyngbya sp. PCC 7376]
Sequence
MSIKDKPPSRARQIGSILLWVTGLFFLFNAFFPTFFGNPTPQVPYSLFISQVEDGQVAKA
SVGDKEIRYQMTDTADQAGAVLRTTPIFDLDLPKRLEANDVEFAAPPPRNNFFGNILGWV
IPPIIFVLIWQFFIGRNAGGGGAGGALSFTRSKAKVYVEEDSTKITFDDVAGVEEAKTEL
TEIVDFLKTPQRYTAIGAKIPKGVLLVGPPGTGKTLMAKAVAGEAGVPFFSISGSEFVEL
FVGAGAARVRDLFEQAKKKAPCIIFIDELDAIGKSRASGGFAGGNDEREQTLNQLLTEMD
GFAAGDATVIVLAATNRPETLDPALLRPGRFDRQVLVDRPDLGGRLKILEIYANKVKLND
EVNLKEIATRTPGFAGADLANLVNEAALLAARNHRETVAQADFAEAIERVVAGLEKKSRV
LSDKEKKIVAYHEVGHALVGALLPGGGKVAKISIVPRGMAALGYTLQMPTEDRFLMDERE
MRDQIATLLGGRSAEEIIFGSITTGAANDLQRATDLAERMVTTYGMSKVLGPLAYEKGQQ
NNFLGEGGMNPRRMVSDETAKAIDAEVKEIVESAHQQALAILKENHGLLETISKKILDTE
VIEGDLLQELLAEVKTPEAIA
Download sequence
Identical sequences K9PXN8
WP_015134022.1.56710 gi|427723812|ref|YP_007071089.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]