SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|427723843|ref|YP_007071120.1| from Leptolyngbya sp. PCC 7376

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|427723843|ref|YP_007071120.1|
Domain Number 1 Region: 107-310
Classification Level Classification E-value
Superfamily Glutathione synthetase ATP-binding domain-like 1.15e-60
Family BC ATP-binding domain-like 0.00000413
Further Details:      
 
Domain Number 2 Region: 7-106
Classification Level Classification E-value
Superfamily PreATP-grasp domain 6.47e-29
Family BC N-terminal domain-like 0.0000681
Further Details:      
 
Domain Number 3 Region: 314-386
Classification Level Classification E-value
Superfamily Rudiment single hybrid motif 2.2e-19
Family BC C-terminal domain-like 0.00078
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|427723843|ref|YP_007071120.1|
Sequence length 389
Comment formate-dependent phosphoribosylglycinamide formyltransferase [Leptolyngbya sp. PCC 7376]
Sequence
MAITLPKKIMMLGSGELGKEVVIAAQRFGNTVIAVDRYDNAPAMQVADHREVISMLDGEA
LEAVVKKYEPDFIVPEVEAIRTEKLLEFERQGYTVIPTAAATNFTMNRDRIRDLAHDELG
LRTAKYAYATSLEELTAVAQKIGFPNVIKPVMSSSGKGQSIVQTAFELEKAWDYAIEGAR
GDTAKIIIEEFIDFEVEITLMTIRQWEGETLFCPAIAHRQERGDYQESWQPVGLTDSQIK
DAQEIACKVTDALGGAGIFGVEFFITKDEVIFSELSPRPHDTGMVTMISQNLNEFELHLR
AILGLPIPTIEQLGPAASAVILATEHSNKISFTGMADALAEPQTDLRLFGKPDSRPYRRM
GVALAKGKDTGDARKKAFDAAQKVKIVYG
Download sequence
Identical sequences K9PZD7
gi|427723843|ref|YP_007071120.1| WP_015134052.1.56710

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]