SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|427723948|ref|YP_007071225.1| from Leptolyngbya sp. PCC 7376

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|427723948|ref|YP_007071225.1|
Domain Number 1 Region: 301-524
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 9.76e-41
Family ABC transporter ATPase domain-like 0.00013
Further Details:      
 
Domain Number 2 Region: 71-286
Classification Level Classification E-value
Superfamily DNA repair protein MutS, domain III 1.26e-19
Family DNA repair protein MutS, domain III 0.018
Further Details:      
 
Domain Number 3 Region: 723-799
Classification Level Classification E-value
Superfamily SMR domain-like 0.00000000732
Family Smr domain 0.0072
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|427723948|ref|YP_007071225.1|
Sequence length 801
Comment MutS2 protein [Leptolyngbya sp. PCC 7376]
Sequence
MTQIQTETLNLLEWQRLCQHLSTFAATKLGAIAARNLVFPGSQAESEILLAQTVEITELD
AETEGGISFEGIGNVSESLERATIGGIISGQDLLLIATTLAGVRKLRRLVENSELELPQL
LFLVEQLRTYPELEKEIHHCIDDRGDVTDRASPKLAGIREKMKGARDGIYQTLNRIMQRH
GGSIQEAVITQRGDRFVLPVKAGQKEHIPGIVHDISSTGSTFYVEPKAIIDLGNRLRQAT
KQEQREIEIILRQLTEKVAEVVEDLEKLLAIATTIDLATARSRYSHWLEANPPKFTKPEQ
PTMLRKLHHPLLVWQQKQEEGDEVVPINVQIRPDIKVVAITGPNTGGKTVTLKTLGMAAL
MAKVGLFIPAIAPVELPWFNHVLADIGDEQSLQQSLSTFSGHIRRVGRIIETLQAEDENN
LVLLDEVGAGTDPTEGSALAIALLKYLADHAALTVATTHYGELKALKYDDDRFENASVEF
DEYSLRPTYKLLWGIPGRSNALAIAKRLGLDEQVIDAAQSLLGNSNTDVNEVIAALEAQR
REQEQKSQEAEALLKQTERFYTEVSSKAADLQRRETELKQAQDQQVQEAIAEAKSEIAQV
IRTLQKGKPSAQKAQKATNALGEIAQEKLAQPKKKKAGYQPKLGEKIRISKLGQTAEVIE
LNEENKTLVARFGIMKMSLQWTEIESLQGQKVEAEPKKTKQKTKKKQQPKQSQEVVTVRT
DSNTIDIRGQRIHQAESSLEGAIARATAQGSQVVWIIHGKGTGKLREGVHEFLKHHPQIK
KYNIAEQKEGGSGVTIAYLSN
Download sequence
Identical sequences K9PZR9
gi|427723948|ref|YP_007071225.1| WP_015134154.1.56710

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]