SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|427723957|ref|YP_007071234.1| from Leptolyngbya sp. PCC 7376

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|427723957|ref|YP_007071234.1|
Domain Number 1 Region: 12-234
Classification Level Classification E-value
Superfamily Adenine nucleotide alpha hydrolases-like 1.61e-48
Family PP-loop ATPase 0.00036
Further Details:      
 
Domain Number 2 Region: 214-312
Classification Level Classification E-value
Superfamily MesJ substrate recognition domain-like 8.37e-18
Family MesJ substrate recognition domain-like 0.0062
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|427723957|ref|YP_007071234.1|
Sequence length 324
Comment tRNA(Ile)-lysidine synthase [Leptolyngbya sp. PCC 7376]
Sequence
MNWSLLHARVHQHLKETQLLPTGQRILVAVSGGQDSLCLGQLLLDLSRRWQWRLAIAHCN
HGWSGDEAIADHVCRIAVTWQLPFFLCAAETPIKETEAAARQWRYQELGAVAITEQFSIV
VTGHTLSDRAETLLFNLARGSGLGGLGALTERRSLTSEVSLVRPLLTVHRDETAAFCTDF
NLPIYEDTYNHNLRFSRNRLRQQVLPELKVINSQAEQHLAQTAIISQAENDYLEAIAAEH
FAKYFAADLSLQRLPLRQIHPALQRRILKQYLIQLLPKQPSFQQIEACRKLIYAPNRSQT
SSFSGDIKFIVNAEYIVPLDKMKK
Download sequence
Identical sequences K9PY61
WP_015134163.1.56710 gi|427723957|ref|YP_007071234.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]