SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|427724026|ref|YP_007071303.1| from Leptolyngbya sp. PCC 7376

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|427724026|ref|YP_007071303.1|
Domain Number 1 Region: 576-678
Classification Level Classification E-value
Superfamily OmpA-like 0.00000000127
Family OmpA-like 0.0047
Further Details:      
 
Weak hits

Sequence:  gi|427724026|ref|YP_007071303.1|
Domain Number - Region: 23-63
Classification Level Classification E-value
Superfamily Intermediate filament protein, coiled coil region 0.0602
Family Intermediate filament protein, coiled coil region 0.0078
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|427724026|ref|YP_007071303.1|
Sequence length 700
Comment transport-associated protein [Leptolyngbya sp. PCC 7376]
Sequence
MPESNQQDNGDRLDFDILRNAILGEQISEYETKISDLEEQISGVREEMRAQGNEVQSAIE
KKIDEILQVIQVAPPQAKETPVSPPNQIPAPTPAQNKPQPVPVAPKFVEQTPPSPAPTPI
QNKPQPVPVAPKFVEPTPPSPAPIPQPKASPTPQPPNTPPSVTPPKLDLTPPKVVTPEPT
SPKVTTPELTSPEPELPKEPTDTSASVDFFSTQINGILNNQAAPKPETKQEQPTPEPTNT
NATINAFAAQINSILTNQVSVETPTNQEQPIEVMASPIPDVIELPSPPPQTTPVTTPQPS
AYSAPQTQSSERQQHQHVVPDDRAAQIQQFRDLMWNEEVLRLRQTNAQLDRQLLQIDQYI
ASSQQPLDELLPLMTDLVQLKIQEAKSVPESVEPVIVQSSNSSESPRPISKPRRFPWRGL
LVGLFVLSLIPIGLYGYWLRRIYLFEQEVAIALQTTPELALYRLTPDISPDIRDKTLYLT
GRLPRQELSDQAAAIARQTLPDFELSNNILVIEEPLDKAQRQAEIEKILTPLNSVNGIQV
DAQLDGDRVTLAGTVLQADDITTIIEAVEQINGIEQITNNIQVETQPISTRVYFDQNSAV
VKPRDIDQKLLLVKQYLARYPNINLRIIGYQHPTEYTADVALKRVQAVQLLLEDKGIDRR
RIIAFGVKQPPPDITSDDPIWLSRTVIFDIARDTSNAGNP
Download sequence
Identical sequences K9Q096
gi|427724026|ref|YP_007071303.1| WP_015134231.1.56710

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]