SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|427724055|ref|YP_007071332.1| from Leptolyngbya sp. PCC 7376

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|427724055|ref|YP_007071332.1|
Domain Number 1 Region: 124-319
Classification Level Classification E-value
Superfamily Glutathione synthetase ATP-binding domain-like 2.6e-51
Family BC ATP-binding domain-like 0.0006
Further Details:      
 
Domain Number 2 Region: 26-120
Classification Level Classification E-value
Superfamily PreATP-grasp domain 6.47e-21
Family BC N-terminal domain-like 0.01
Further Details:      
 
Domain Number 3 Region: 325-382
Classification Level Classification E-value
Superfamily Rudiment single hybrid motif 0.0000000000000651
Family BC C-terminal domain-like 0.002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|427724055|ref|YP_007071332.1|
Sequence length 402
Comment 5-(carboxyamino)imidazole ribonucleotide synthase [Leptolyngbya sp. PCC 7376]
Sequence
MSCRLIDAGLRFDSLNMQEVQDSMKQRVGVIGGGQLAWMMGAEAKTLGLELWLQTPNASD
PAVARADKTILADLQDITATAKLSEECAVVTFENEFVDLEALGKLAAQGANFRPSLAFLE
PLLDKYDQRRCCEKFNILVPHYQAWSLTDGLPEGWQYPLVIKARRHGYDGKGTFVIKNEA
ELKALPTGLEQTPLLLEAFVPFEQELAVMVARSASGDIRVFPVVETQQIHQVCHWAIAPA
AVNNTVEDKVIHIAQTLAENLGLVGIMGIELFLTPAGEVLVNEIAPRTHNSGHFSLDACQ
TSQFAMQLQAIAGLPLGSPDLLVKGAVMVNLLGFEHSDSDYDHKRQILTQMPDSHVHWYG
KAGASPGRKLGHVTITSPTDDRSTLMAIAKKIERLWYAQSDE
Download sequence
Identical sequences K9PZD1
gi|427724055|ref|YP_007071332.1| WP_015134260.1.56710

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]