SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|427724143|ref|YP_007071420.1| from Leptolyngbya sp. PCC 7376

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|427724143|ref|YP_007071420.1|
Domain Number 1 Region: 474-647
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 3.05e-45
Family Pyruvate oxidase and decarboxylase PP module 0.00059
Further Details:      
 
Domain Number 2 Region: 113-288
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 5.4e-42
Family Pyruvate oxidase and decarboxylase Pyr module 0.0002
Further Details:      
 
Domain Number 3 Region: 299-462
Classification Level Classification E-value
Superfamily DHS-like NAD/FAD-binding domain 3.47e-39
Family Pyruvate oxidase and decarboxylase, middle domain 0.0018
Further Details:      
 
Domain Number 4 Region: 6-108
Classification Level Classification E-value
Superfamily ISP domain 7.07e-27
Family Rieske iron-sulfur protein (ISP) 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|427724143|ref|YP_007071420.1|
Sequence length 650
Comment acetolactate synthase [Leptolyngbya sp. PCC 7376]
Sequence
MANTSTQWFKVLAPDELPEGRVKTVIAGHKGLALTHYDGQYGALDNRCPHQGGPLGEGSI
ENGLLRCPWHGWDYCPLTGQSPGAFDDDDALETFPVEVREDGVYVGLPVEDPHTRTVSDV
MAETMVNWGVTHVFGMVGHSNLGLADALRRQEEQGNITFFGIRHEGAAAFAAAAYGKLTG
RPAACLTIAGPGATNLLTGMWDAKVDRSPILALTGQVNSQVLGTGNFQECDLGAAFSGVA
AWSQTVLSHSKHAELMTLAVKNALLQRDVSHLIFPDEVQVQAAVDVPASSPTGRITPLQI
APPPDALQKAIARLKQSRRPVIIVGHGSRFNMPAIIELAELLGAPILTTFKAKGQISDRH
PLGCGVLGRSGTPIASWFMNESDLLLVFGASFSNHTGISAKKPIIQVDFDPLALGKFHPV
EVPVWGEISIVVEQLKTALTGQVNTENRREEIADRWAIWREEKIRREADDRGQGLGSAAI
FAAMTRQIPANAVISVDVGNNTYSFGRYFECEAQSVLMSGYLGSIGFSFPAAMGAWAAAG
HERPIVSVSGDGGFGQYLAEFTTAVKYDMNITHFLVNNSQLGKISKEQRAGEWDVWQTSL
HNPDFSKYAEICGGLGIRVTKKEELDDAMQRALEYKGPALVEMIADAELI
Download sequence
Identical sequences K9Q098
WP_015134348.1.56710 gi|427724143|ref|YP_007071420.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]