SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|427724180|ref|YP_007071457.1| from Leptolyngbya sp. PCC 7376

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|427724180|ref|YP_007071457.1|
Domain Number 1 Region: 404-521
Classification Level Classification E-value
Superfamily OmpA-like 9.03e-19
Family OmpA-like 0.0016
Further Details:      
 
Domain Number 2 Region: 80-282
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 0.0000000000206
Family Phosphate binding protein-like 0.031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|427724180|ref|YP_007071457.1|
Sequence length 527
Comment OmpA/MotB domain-containing protein [Leptolyngbya sp. PCC 7376]
Sequence
MSQKENPLTLVAALLVTMGILGGGLWFLGNRSPGFLEEIFGNDPSSKDSPTKSTRNLEQG
NITLLGDTFSGYSTFRNAEFQEALQEVGITLSYGNEFDQTARANLLNEGKADLYVTTLDQ
FLKQNPEGKIVGLIDRTIGADAVVLNNKQYPDLNSLNSLQTLQQSAQGESLSITYAVDTP
SEYLALVLSTAFDGFNLSDFDVKEVVDASEAWQALQNPAENVAVAVLWEPFVSQARNAGY
TVVLSSNDAPTAILDVIVASDRLLTARPDLVSDFLEAYYRHIDANIREPSQLRAQIATDG
ELTPSEADSILEGIDFFTSIEAKNWIQAGTLEQRIGSTAAVLVLSGKLNQVPTDINSLFT
DEYVNKAALNTQTLIDLIKVDNPELADRLAGKGTTIQAVPQVAASEVAQASDIGNLQVRG
EVNFATGSATLSQQSQTTLEQLVNQIKEFNPQTVGIRVIGHTSKTGDPKLNQTLSQQRAQ
VVVDGLRQRGLQHNIIAEGKGFYLPLSGIAPEDPKQQRTEIRLVRLN
Download sequence
Identical sequences K9PZQ0
gi|427724180|ref|YP_007071457.1| WP_015134384.1.56710

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]