SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|427724207|ref|YP_007071484.1| from Leptolyngbya sp. PCC 7376

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|427724207|ref|YP_007071484.1|
Domain Number 1 Region: 132-351
Classification Level Classification E-value
Superfamily Glutathione synthetase ATP-binding domain-like 6.72e-46
Family ATP-binding domain of peptide synthetases 0.00026
Further Details:      
 
Domain Number 2 Region: 4-130
Classification Level Classification E-value
Superfamily PreATP-grasp domain 0.00000000000000317
Family D-Alanine ligase N-terminal domain 0.0038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|427724207|ref|YP_007071484.1|
Sequence length 354
Comment D-alanine--D-alanine ligase [Leptolyngbya sp. PCC 7376]
Sequence
MPIILGLLFGGRSGAHNVSVGAAQDIYKALQTSKYSKKYHVIPFYIQRDGRFAPKKIATS
YLDNKNHGWSFDQSELPKESLVFTDELTTIDVCLSTILCGVGSGDGSIQGFIETLQIPLV
GSSVLGASIGADKITMKRVFAQMNIPQVKYISIDKSKLFSSSKSLDNFCDEVEKSFRYPY
FVKPSRLGSSLGISMANNRQELKDGFQLASSYDHRIIVEQGIKARELSCAVLGNIAPQIS
ILAEKVYENSFNSYDTKYKANQGQFKLVQDLPDSITQDIKKLANLAFKAIACLDACRIDF
FLLEDNQTVMINEVNTVFGFKESSMFSFLWKSVGIEFPDLIDKLITLALERKNL
Download sequence
Identical sequences K9PYU9
gi|427724207|ref|YP_007071484.1| WP_015134410.1.56710

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]