SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|427724259|ref|YP_007071536.1| from Leptolyngbya sp. PCC 7376

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|427724259|ref|YP_007071536.1|
Domain Number 1 Region: 32-267
Classification Level Classification E-value
Superfamily PLP-binding barrel 1.96e-68
Family Alanine racemase-like, N-terminal domain 0.0000264
Further Details:      
 
Domain Number 2 Region: 259-393
Classification Level Classification E-value
Superfamily Alanine racemase C-terminal domain-like 1.43e-50
Family Alanine racemase 0.0001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|427724259|ref|YP_007071536.1|
Sequence length 394
Comment alanine racemase [Leptolyngbya sp. PCC 7376]
Sequence
MLDGEKLSHIVSQGCRHYQFSDAIRQRAWVEINHAALAHNIQALKALLAPHTELLAVVKA
DAYGHGVIKIAETVLANGATWLAIATLGEGVELREAGITAPILVLGATNTAIEIEAIAHW
ELQPTLCTIEQQQLFQKTMARLGKTLPVHLKIDTGMSRLGTRWEEAPLFIEAVHSSENLE
IASLYSHFATADEQDLTMTHLQHQRFKQALAELKQRDIPLPKLHLSNSAGTILGQAFHYD
LVRVGLAIYGAYPAPHLEEKVDLKPVMQVKARITQLKTLPPETGVSYGHRFVTATETKIA
VVGIGYADGIPRTLSNNLKVLVNGQLAPQIGSITMDQIMLDVTHLTNVQVGDVVTLIGED
GSDRLTVDQWANQLGTISYEIMCGFKHRLPRINL
Download sequence
Identical sequences K9Q1R4
gi|427724259|ref|YP_007071536.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]