SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|427724290|ref|YP_007071567.1| from Leptolyngbya sp. PCC 7376

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|427724290|ref|YP_007071567.1|
Domain Number 1 Region: 29-164
Classification Level Classification E-value
Superfamily Nucleotidylyl transferase 4.93e-21
Family Cytidylyltransferase 0.0094
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|427724290|ref|YP_007071567.1|
Sequence length 168
Comment cytidyltransferase [Leptolyngbya sp. PCC 7376]
Sequence
MKNDQEMDQVYSLAELKQAIATNPEQWRPLIFTNGCFDLLHVGHTRYLAAAKALGKTLVV
GLNSDHSIRQIKPQPAHLPQRPIVPEAQRAELLTALGAVDAVVVFDEPTAQEAIAALQPD
IYVKGGDYTPETLPETPTVNSYGGKIELIQIEIPTSTSGIIKKILKEQ
Download sequence
Identical sequences K9Q014
gi|427724290|ref|YP_007071567.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]