SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|427724306|ref|YP_007071583.1| from Leptolyngbya sp. PCC 7376

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|427724306|ref|YP_007071583.1|
Domain Number 1 Region: 27-196
Classification Level Classification E-value
Superfamily Ligand-binding domain in the NO signalling and Golgi transport 1.2e-34
Family MJ1460-like 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|427724306|ref|YP_007071583.1|
Sequence length 235
Comment 4-vinyl reductase 4VR [Leptolyngbya sp. PCC 7376]
Sequence
MVLSSPSSSNTSRPSSQLKTCHFSRYNFFQFNADSGTVLDKNKQRNLITTEDFIIGLQKG
LEHEVGEASGWLMYLIGKEWGQADAEEFKVWFQEDYGLHFKDAALRFALETWWWPLTAQG
WGKWEVDLSSIKEGFLFIDLFDSAVAKSLGDVGKPVCFLYAGLFAGFFSSFFERSLSSTE
IQCYSMGNDFCRFLIGSEKRVKAAEFWLTSGATASDIEDRFQAIRSEAELSKIGN
Download sequence
Identical sequences K9Q0Y9
WP_015134507.1.56710 gi|427724306|ref|YP_007071583.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]