SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|427724419|ref|YP_007071696.1| from Leptolyngbya sp. PCC 7376

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|427724419|ref|YP_007071696.1|
Domain Number - Region: 203-346
Classification Level Classification E-value
Superfamily Enolase C-terminal domain-like 0.0162
Family Enolase 0.042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|427724419|ref|YP_007071696.1|
Sequence length 661
Comment hypothetical protein Lepto7376_2591 [Leptolyngbya sp. PCC 7376]
Sequence
MTQKRNVSSPTISAGAQNTMKTSSDQQQSSQQTARPKSVELVEVDKEEAPPKQRTIPLPS
WHFLGLVLILLSGGVGFAATSILLSFNGSSNCNALYVPLASATTRLYCAQVEAEQQTLGS
YLKAIRMVDGFPQDHPLRPDIDRNIEVWTSDILELAEVQFQEGNLDEAIAIAEEVPVRST
ARILVEERIEDWRLVWRDGERIFAKLDREINDGDLSAALRTAVELSYLENIYWSTVKYEE
ARNQIQLARKENEELDVAYVSHRRGGIENWLQAIEQASKISEDSYAYPQAQKLIDDSREN
IIRYIEDLVDQQQWDQLMSLSDRLPGRLNLDNMVVDWKILAQAGLSARRGSVIDLETALV
QIQSIQPSSSVYDQSQTLMNRWQSEIADVTLLEQGDAIAAGGTITDLQRAIAKLNLIEEG
NPRYGEARRKVAQWREKIEISEDRPTLQYARDLASSRGTNALNEAIVQARKIQPGRALYD
EAQSAIREWQGTIERREDQPIYDQAIALGNNQRYSEAITVANQITAGRALYPKMQEKVGG
WRRELTAATKLRDAYNAASRETISGLVEAIRLTQEIPSSASAARSEGREAANQWSYGILN
EAQRQANTASIPEAIATAELIPSGTAAYSSAQVQIEAWERLMRPAPPVETSENDVFLDPQ
I
Download sequence
Identical sequences K9Q284
WP_015134617.1.56710 gi|427724419|ref|YP_007071696.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]