SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|427724561|ref|YP_007071838.1| from Leptolyngbya sp. PCC 7376

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|427724561|ref|YP_007071838.1|
Domain Number 1 Region: 22-215
Classification Level Classification E-value
Superfamily Class I glutamine amidotransferase-like 1.08e-55
Family Class I glutamine amidotransferases (GAT) 0.00000651
Further Details:      
 
Domain Number 2 Region: 203-430
Classification Level Classification E-value
Superfamily Adenine nucleotide alpha hydrolases-like 2.43e-53
Family N-type ATP pyrophosphatases 0.00000189
Further Details:      
 
Domain Number 3 Region: 417-537
Classification Level Classification E-value
Superfamily GMP synthetase C-terminal dimerisation domain 1.7e-52
Family GMP synthetase C-terminal dimerisation domain 0.0000159
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|427724561|ref|YP_007071838.1|
Sequence length 537
Comment GMP synthase [Leptolyngbya sp. PCC 7376]
Sequence
MTTTPLNKTTDTDSKANNLQRQMLVILDFGSQYSELIARRIRETEVYSEVISYRTTAEQL
KQLNPRGIILSGGPSSVYDEFAPECDPEIWNLGIPVLGVCYGMQLMVKQLGGTVERAEHA
EYGKASLQIDDPTDLLTNVGEGSTMWMSHGDSCVNLPDGFELLAHTDNTPRAAVADHQRK
LYGVQFHPEVVHSKDGMALIRNFVYHICECEPTWTTEAFVEESIREIRARIGDQKVLLAL
SGGVDSSTLAFLLNRAIGDQLTCMFIDQGFMRKGEPERLMEIFDEQFNIAVEYINARDRF
IDMLDGVTDPEKKRKLIGHEFIAVFEEESKRLGPFDYLAQGTLYPDVIESADTNVDPKTG
ERVAVKIKSHHNVGGLPKDLRFKLVEPLRKLFKDEVRKVAANIGLPQEIIRRHPFPGPGL
AIRIIGEVTSERLNILRDADWVVRDEIKKQNVYSDFWQAFAVLLPIRSVGVMGDKRTYAH
PVVLRMITSEDGMTADWARPPYELLETISNRIVNEVKGVNRVVYDITSKPPGTIEWE
Download sequence
Identical sequences K9Q1R1
gi|427724561|ref|YP_007071838.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]