SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|427724983|ref|YP_007072260.1| from Leptolyngbya sp. PCC 7376

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|427724983|ref|YP_007072260.1|
Domain Number 1 Region: 125-294
Classification Level Classification E-value
Superfamily Nicotinate/Quinolinate PRTase C-terminal domain-like 1.14e-60
Family NadC C-terminal domain-like 0.0000127
Further Details:      
 
Domain Number 2 Region: 11-124
Classification Level Classification E-value
Superfamily Nicotinate/Quinolinate PRTase N-terminal domain-like 1.1e-25
Family NadC N-terminal domain-like 0.0028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|427724983|ref|YP_007072260.1|
Sequence length 296
Comment nicotinate-nucleotide pyrophosphorylase [Leptolyngbya sp. PCC 7376]
Sequence
MTIRIATHKVLVTPPAWLLVDPFLKQWLQEDLGRGDRTTEALFTNKKIPTGQAQLILKAP
GIVAGLPFVERVFQLIGPDFEMQAALAEGKDGQPKTLIATLTAPLDTLLMGERVALNILM
RLSGIATETAHYARKIEDLPTTLVDTRKTTPGLRLLEKYAVRVGGGRNHRYGLDDAMMIK
DNHIQAAGGITEAIAAVRANSPYPLAIEVEAETLEQAIEAVQQGADIVMLDNMSPAKMAE
VIPPLREINPRIKLEASGNITLETIRAVAETGIDFISTSATITRAPWLDISMKITA
Download sequence
Identical sequences K9Q2R5
WP_015135173.1.56710 gi|427724983|ref|YP_007072260.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]