SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|427725168|ref|YP_007072445.1| from Leptolyngbya sp. PCC 7376

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|427725168|ref|YP_007072445.1|
Domain Number 1 Region: 183-642
Classification Level Classification E-value
Superfamily (Trans)glycosidases 1.58e-115
Family Amylase, catalytic domain 0.00000000607
Further Details:      
 
Domain Number 2 Region: 650-752
Classification Level Classification E-value
Superfamily Glycosyl hydrolase domain 1.39e-33
Family alpha-Amylases, C-terminal beta-sheet domain 0.00064
Further Details:      
 
Domain Number 3 Region: 14-118
Classification Level Classification E-value
Superfamily E set domains 0.00000000000076
Family E-set domains of sugar-utilizing enzymes 0.035
Further Details:      
 
Domain Number 4 Region: 142-198
Classification Level Classification E-value
Superfamily E set domains 0.0000000616
Family E-set domains of sugar-utilizing enzymes 0.0016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|427725168|ref|YP_007072445.1|
Sequence length 774
Comment glycogen branching protein [Leptolyngbya sp. PCC 7376]
Sequence
MPTVTTSEQVHQIVSNHHDNPHTILGHHSIELGGTMTWLVRTYLPRAEQAWVIDPVSQKE
YPMTSVHNPNFFECILEQELPPQYKLKYKSGDDYFTIYDPYEFVEAPHISDLDLHLFAEG
NHHRIYDKLGAHLLNIKGIEGVYFSVWAPNARNISVIGDFNNWDGREHQMRKLGVGVWGI
FIPELGVNTQYKYEIKNYEGHIYEKSDPYGFFQEVRPNTASIVADLDQYEWNDEAWLKQR
EASDPLKQPVSIYELHLGSWLHASAEEPMALLSGEVAPIPVNETKEGARYLSYYELVDKL
IPYVVEMGYTHIELLPIAEHPFDGSWGYQVTGYYAPTSRFGRPEDLMYFIDQCHANGIGV
LVDWVPGHFPKDGHGLAFFDGTHLYEHADPRKGEHKEWGTLIFNYNRNEIRNFLVANALF
WFDKYHIDGIRVDAVASMLYLDYDREDGEWLPNDYGGNEHLEAVDFLRQTNNLIFKYYPG
VISVAEESTAWPMVSRPTYLGGLGFNLKWNMGWMHDNLSYFSTDPWFRQHNQNSITFSMW
YHFSENYMLALSHDEVVHGKSSILGKMPGDDWQKFANVRALFTYMFMHPGKNTMFMSMEF
GQWNEWNVWTDLNWDLLDHEPHAKLKSFFAALNAFYKEQPALYELDFEEEGFDWIDCSDN
QNSVVSFVRRAKDPKDFLVVVCNFTPQLHPHYRVGMPEAGCYDEVFTSDMETFGGSNNKN
FGGVWTEEWGMHGQPYSADLCLPSLGVVVLKINRERTAEAIASQQSQTESHSLT
Download sequence
Identical sequences K9Q395
gi|427725168|ref|YP_007072445.1| WP_015135352.1.56710

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]