SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|427725328|ref|YP_007072605.1| from Leptolyngbya sp. PCC 7376

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|427725328|ref|YP_007072605.1|
Domain Number 1 Region: 553-978
Classification Level Classification E-value
Superfamily DNA/RNA polymerases 4.45e-138
Family DNA polymerase I 0.0000000167
Further Details:      
 
Domain Number 2 Region: 3-181
Classification Level Classification E-value
Superfamily PIN domain-like 4.42e-45
Family 5' to 3' exonuclease catalytic domain 0.0000384
Further Details:      
 
Domain Number 3 Region: 360-546
Classification Level Classification E-value
Superfamily Ribonuclease H-like 1.75e-41
Family DnaQ-like 3'-5' exonuclease 0.00022
Further Details:      
 
Domain Number 4 Region: 182-293
Classification Level Classification E-value
Superfamily 5' to 3' exonuclease, C-terminal subdomain 3.14e-32
Family 5' to 3' exonuclease, C-terminal subdomain 0.00036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|427725328|ref|YP_007072605.1|
Sequence length 979
Comment DNA polymerase I [Leptolyngbya sp. PCC 7376]
Sequence
MTKPLLLLIDGHSLAFRCYYAFSKSRNGALRTSTGIPTSICFGFLNALERVIENQKPTSV
AIAFDLPKPTFRHEADENYKANRSETPDDFVPDYLNLRDLLTSLNVTQVTAEGYEADDVL
ATLAHQASEAGQQVKILTGDRDLFQLVNPEKSTSILYLDTRGVRSGAYQEFDPEAVEEKL
GVLPEQVIDFKALAGDSSDNYKGVKGIGEKTAIKLIKEFGTLDNIYANLDNIKGATKKKL
IEDKESAYHCQKLARISLEAPFDIPLVDLNLKGFEVDKAVEILTKLELKKFIQGIGKLQQ
TFGAEKIEIPKPTAVNLDNSQVNAVGNEQLSIFASPAVEIPESKPPEPAITEEFLKPSII
DTAEKLDELVELLKTKTDPNDPIAWDTETTGLDPREVDLVGIGCGWGVEPTDVAYIPIAH
TTGEQLSREKIYQALQPILASDKYPKVFQNAKFDRAIFNHQGLDLNGVVFDTMLASYVLH
PESKHNLTDLSLRYIGNIVAKSYKDLGLTKKQTIADLDIPTAADYCGLDVYTTYALFEKL
KNELDKVEDVDKLLREVELPLEPVLCQMESDGIRIDLGYLKELSDELGADLDDIEDRAYN
AADERFNLNSPKQLGEILFDKLGLNTKKTRKTKTGAYSTNQSVLEKLQGDHPIIDYILEY
RTLAKLKSTYVDALPTLVSKKTGCVHTDFNQTITSTGRLSSSNPNLQNIPVRTEFSKRIR
KAFIPRDGWILAAADYSQIELRILTHLSQEPTLLNAYNTGEDVHRITAQLIFEKDTPEEV
TTEERRLGKIINFGVIYGMGSQRFAREAGVPKSQSKEFIERYHERYSKVFEYLELVKKQA
IAQGYVTTILNRRRNFNFASPSLQALKGSDAQAIDIETLQKNRKINYNDIQALRAAANAP
IQGSSADIIKVAMIQIQELLKNYEAKLLLQVHDELVFEMPPEEWDELQEKIKSTMENAVS
LSIPLVVEINRGANWMEAK
Download sequence
Identical sequences K9Q3P1
WP_015135509.1.56710 gi|427725328|ref|YP_007072605.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]