SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|427725331|ref|YP_007072608.1| from Leptolyngbya sp. PCC 7376

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|427725331|ref|YP_007072608.1|
Domain Number 1 Region: 113-462
Classification Level Classification E-value
Superfamily Nucleotidylyl transferase 1.85e-92
Family Class I aminoacyl-tRNA synthetases (RS), catalytic domain 0.00000625
Further Details:      
 
Domain Number 2 Region: 463-585
Classification Level Classification E-value
Superfamily Anticodon-binding domain of a subclass of class I aminoacyl-tRNA synthetases 1.18e-31
Family Anticodon-binding domain of a subclass of class I aminoacyl-tRNA synthetases 0.00088
Further Details:      
 
Domain Number 3 Region: 8-96
Classification Level Classification E-value
Superfamily Arginyl-tRNA synthetase (ArgRS), N-terminal 'additional' domain 2.09e-23
Family Arginyl-tRNA synthetase (ArgRS), N-terminal 'additional' domain 0.002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|427725331|ref|YP_007072608.1|
Sequence length 585
Comment arginyl-tRNA synthetase [Leptolyngbya sp. PCC 7376]
Sequence
MQSILSQLKNANSAALAKAFGEEYKDTDPLVVQASNPKFGDYQSNVALSLTKILKKNPRV
IAQEIIDALDVADLCEAPTIAGPGFINFTLKPSYLEILLKELQQSDRLGIDKTTDPQKVI
VDFSSPNIAKEMHVGHLRSTIIGDSIARVLEFRGQDVVRLNHVGDWGTQFGMLITYLREA
YPDALTQADALDIGDLVAFYKKAKIRFDDDEEFKENSRKQVVALQSGDEESNQAWQLLCD
QSRREFQKIYDILDIKITERGESFYNPYLADVVTDLKKVGLLEKDAGAQCVFLEGFKNKD
GDRLPLIVQKSDGGFNYATTDLAAIRYRIKEDGAERIVYVTDSGQAGHFAQVFQVAKRAE
FLTDDVEAVHVPFGLVQGEDGKKLKTRSGETIKLKDLLNEAVVRSRADIEKRLQEYDSQE
SPEFIEQVAKVVGIGAVKYADLSQNRTSNYIFSFDKMLTLQGNTAPYMLYAYVRVQGVSR
QGGIDLANLPTDTPIILSEPAELTLAKHIFQLGEVLEVVERELMPNRLCEYLYELSRKFN
QFYEACPILKAEGDRRTSRLILADTTARTLKLGLSLLGIEVLDRM
Download sequence
Identical sequences K9Q3W0
WP_015135512.1.56710 gi|427725331|ref|YP_007072608.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]