SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|427725361|ref|YP_007072638.1| from Leptolyngbya sp. PCC 7376

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|427725361|ref|YP_007072638.1|
Domain Number 1 Region: 527-688
Classification Level Classification E-value
Superfamily Pentapeptide repeat-like 2.16e-36
Family Pentapeptide repeats 0.00061
Further Details:      
 
Domain Number 2 Region: 708-843
Classification Level Classification E-value
Superfamily Pentapeptide repeat-like 2.98e-32
Family Pentapeptide repeats 0.00073
Further Details:      
 
Domain Number 3 Region: 825-904
Classification Level Classification E-value
Superfamily Pentapeptide repeat-like 0.000000000141
Family Pentapeptide repeats 0.003
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|427725361|ref|YP_007072638.1|
Sequence length 919
Comment pentapeptide repeat-containing protein [Leptolyngbya sp. PCC 7376]
Sequence
MTVTQTKLTAILARLEKLETRQNLLKNNLLSLKKQVDGLATSFQNRPELAQVRSIQNTLD
ELARFGDRLDSSIDIDAALTPQPIRTSETTMGGIDPDVLVMPILENDSELEEALDADLSS
DLSTLLNTLEIDDAANLDGLALDPMNLDMADALEDNGGDRLSTLDFDLDNIDLENISLDE
LEQLDIYALGGVSDEVDLSLDLSDSLSSDLEALELTDVEQVNDADDLPELNNEQLNGNAV
SLSDAEGTPISKLGGEVELENMELDPLAMNGMDLENLSDLDIEELTGVELNDLSLGEHLP
TIDLSGDRPAETEDHDDELAVTEPSAEMPMELDNIELPDLAITTDMGELDLNMDNLELEI
AAEMPDYDDMTDFKVESESTIPNIADDLLEPPSITPVPEEEIKSISTTEFEQVNEPSPGI
TDDASQTSEQLSLGTDESEIDQPEIDEPEIDSLSLDVEDVAIASPESPNEASEISVESES
ALSNPRIPVTDTEDPEELTDAETSLSDGTASSIELTAAEIVSRIENRQHYFIGFQLPQIQ
LTQQNLRDCVFDKTNLNGSQLQNSDLRDTSFKNCDLANANLEYTSLERANFEQANLANAN
LKGILFNGRTSFISANLEGADLSNLDLTRPPEFKQANLRRAKLIGVNLRSVNCSGWDLTE
TLLCRANLIHADLRNTTLTNADLSGAIYSTKTMFPEGFQPEGALLVAAGEDLSKQDLQHY
DLSELDLTKVNFSGANLEQANLDNCDLSDANLSSANLRRSHLRAICLEANFTGANLTQAD
LCEANVTGSNFSDANLQGAVLKDANFTMTDLRGTQLKESDTYRMNCNGANLENMDLTGLN
FEGDLSGTNLTNTKLCNLNLNFLDLSWANLTGADVTGSTFKETNLDNANLRDVIGFTLDN
YDYKLYLNNTILPDGKVLD
Download sequence
Identical sequences K9Q3Z2
WP_015135542.1.56710 gi|427725361|ref|YP_007072638.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]